KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0295
Entry
NWMN_0295         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: Collagen_bind
Other DBs
NCBI-ProteinID: BAF66567
UniProt: A0A0H3KE63
Position
344123..344473
AA seq 116 aa
MTLYEDVKLLLKKNGVEVKSDEEEIFKMEVDGILEDVRDITNNDFMKDGQVIYPYSIKKY
VADVLEYYQRPEVKKNLKSRSMGTVSYTYNDGVPDYISGVLNRYKRAKFHPFKSIR
NT seq 351 nt   +upstreamnt  +downstreamnt
atgactctttatgaagatgttaaacttttactcaagaaaaatggagtggaagttaaaagt
gatgaagaagaaatatttaagatggaagttgacggaatactagaagatgttagggatata
acaaacaatgattttatgaaagatggtcaagtcatttatccttactcaatcaaaaagtat
gtcgcagacgtcctagagtattatcaacgacctgaagttaaaaagaatttaaagtcaaga
agtatggggacagtgtcgtacacttataacgatggtgtccctgattacattagtggagta
ttaaacaggtataaacgagcaaagtttcatccgtttaaatcaataaggtag

DBGET integrated database retrieval system