KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0298
Entry
NWMN_0298         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: DUF3168
Other DBs
NCBI-ProteinID: BAF66570
UniProt: A0A0H3KAM9
Position
345233..345658
AA seq 141 aa
MWVSVEPELTNQIYKRLISDPNINKLVDDRVFDVVQDDAVYPYIVVGESNVTNNESSATM
RETVGIVIHVYSQFATQYEAKLILSAIGYVLNRPIEIDNYEFQFSRIDSQAVFPDIDRFT
KHGTIRLLFKYRHKKKNEGVY
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtgggtatcagttgagcctgaacttacaaatcaaatatataaaagattaatctcagac
cctaacattaacaaactagttgatgatagggtctttgacgttgttcaagatgacgctgtt
tacccatatattgttgtgggtgaatcaaacgtcactaacaacgaatctagcgcaacaatg
agagaaacagtcggtattgtcatacatgtgtattcacagttcgctacacaatacgaggct
aagctcattttaagcgcgataggttatgtgcttaacagacctatagaaatagataattac
gagtttcaatttagccgtatcgatagtcaagcagtattccctgatatagacaggtttact
aagcatggcacgatacggcttttatttaagtacagacataaaaagaaaaacgaaggagtg
tattaa

DBGET integrated database retrieval system