KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0346Help
Entry
NWMN_0346         CDS       T00557                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00071  Fatty acid degradation
sae00072  Synthesis and degradation of ketone bodies
sae00280  Valine, leucine and isoleucine degradation
sae00310  Lysine degradation
sae00362  Benzoate degradation
sae00380  Tryptophan metabolism
sae00620  Pyruvate metabolism
sae00630  Glyoxylate and dicarboxylate metabolism
sae00640  Propanoate metabolism
sae00650  Butanoate metabolism
sae00900  Terpenoid backbone biosynthesis
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01120  Microbial metabolism in diverse environments
sae01130  Biosynthesis of antibiotics
sae01200  Carbon metabolism
sae01212  Fatty acid metabolism
sae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NWMN_0346
   00630 Glyoxylate and dicarboxylate metabolism
    NWMN_0346
   00640 Propanoate metabolism
    NWMN_0346
   00650 Butanoate metabolism
    NWMN_0346
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NWMN_0346
   00072 Synthesis and degradation of ketone bodies
    NWMN_0346
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NWMN_0346
   00310 Lysine degradation
    NWMN_0346
   00380 Tryptophan metabolism
    NWMN_0346
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NWMN_0346
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NWMN_0346
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NWMN_0346
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sae04147]
    NWMN_0346
Enzymes [BR:sae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NWMN_0346
Exosome [BR:sae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NWMN_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: BAF66618
UniProt: A0A0H3K675
Position
395604..396785
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system