KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0367Help
Entry
NWMN_0367         CDS       T00557                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00010  Glycolysis / Gluconeogenesis
sae00260  Glycine, serine and threonine metabolism
sae00680  Methane metabolism
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01120  Microbial metabolism in diverse environments
sae01130  Biosynthesis of antibiotics
sae01200  Carbon metabolism
sae01230  Biosynthesis of amino acids
Module
sae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sae_M00002  Glycolysis, core module involving three-carbon compounds
sae_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NWMN_0367
  Energy metabolism
   00680 Methane metabolism
    NWMN_0367
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NWMN_0367
Enzymes [BR:sae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NWMN_0367
Membrane trafficking [BR:sae04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NWMN_0367
Exosome [BR:sae04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NWMN_0367
  Exosomal proteins of melanoma cells
   NWMN_0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAF66639
UniProt: A0A0H3K6X8
Position
415111..415692
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSRAEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
cgatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatattgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggcagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system