KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0756Help
Entry
NWMN_0756         CDS       T00557                                 

Gene name
clfA
Definition
(GenBank) clumping factor A
  KO
K14201  clumping factor A
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:sae00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    NWMN_0756 (clfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SdrG_C_C Big_8 YSIRK_signal Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: BAF67028
UniProt: Q53653
Structure
PDB: 

Position
849757..852558
Genome map
AA seq 933 aa AA seqDB search
MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQSDSASNESKSNDSS
SVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNATTEETPVTGEATTT
TTNQANTPATTQSSNTNAEELVNQTSNETTFNDTNTVSSVNSPQNSTNAENVSTTQDTST
EATPSNNESAPQSTDASNKDVVNQAVNTSAPRMRAFSLAAVAADAPAAGTDITNQLTNVT
VGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAG
DQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTT
ANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNT
DSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPD
DQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGID
KPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSA
SDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSD
SDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSASD
SDSGSDSDSSSDSDSESDSNSDSESGSNNNVVPPNSPKNGTNASNKNEAKDSKEPLPDTG
SEDEANTSLIWGLLASIGSLLLFRRKKENKDKK
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaagaaaaaagaaaaacacgcaattcggaaaaaatcgattggcgtggcttca
gtgcttgtaggtacgttaatcggttttggactactcagcagtaaagaagcagatgcaagt
gaaaatagtgttacgcaatctgatagcgcaagtaacgaaagcaaaagtaatgattcaagt
agcgttagtgctgcacctaaaacagacgacacaaacgtgagtgatactaaaacatcgtca
aacactaataatggcgaaacgagtgtggcgcaaaatccagcacaacaggaaacgacacaa
tcatcatcaacaaatgcaactacggaagaaacgccggtaactggtgaagctactactacg
acaacgaatcaagctaatacaccggcaacaactcaatcaagcaatacaaatgcggaggaa
ttagtgaatcaaacaagtaatgaaacgacttttaatgatactaatacagtatcatctgta
aattcacctcaaaattctacaaatgcggaaaatgtttcaacaacgcaagatacttcaact
gaagcaacaccttcaaacaatgaatcagctccacagagtacagatgcaagtaataaagat
gtagttaatcaagcggttaatacaagtgcgcctagaatgagagcatttagtttagcggca
gtagctgcagatgcaccggcagctggcacagatattacgaatcagttgacgaatgtgaca
gttggtattgactctggtacgactgtgtatccgcaccaagcaggttatgtcaaactgaat
tatggtttttcagtgcctaattctgctgttaaaggtgacacattcaaaataactgtacct
aaagaattaaacttaaatggtgtaacttcaactgctaaagtgccaccaattatggctgga
gatcaagtattggcaaatggtgtaatcgatagtgatggtaatgttatttatacatttaca
gactatgtaaatactaaagatgatgtaaaagcaactttgaccatgcccgcttatattgac
cctgaaaatgttaaaaagacaggtaatgtgacattggctactggcataggtagtacaaca
gcaaacaaaacagtattagtagattatgaaaaatatggtaagttttataacttatctatt
aaaggtacaattgaccaaatcgataaaacaaataatacgtatcgtcagacaatttatgtc
aatccaagtggagataacgttattgcgccggttttaacaggtaatttaaaaccaaatacg
gatagtaatgcattaatagatcagcaaaatacaagtattaaagtatataaagtagataat
gcagctgatttatctgaaagttactttgtgaatccagaaaactttgaggatgtcactaat
agtgtgaatattacattcccaaatccaaatcaatataaagtagagtttaatacgcctgat
gatcaaattacaacaccgtatatagtagttgttaatggtcatattgatccgaatagcaaa
ggtgatttagctttacgttcaactttatatgggtataactcgaatataatttggcgctct
atgtcatgggacaacgaagtagcatttaataacggatcaggttctggtgacggtatcgat
aaaccagttgttcctgaacaacctgatgagcctggtgaaattgaaccaattccagaggat
tcagattctgacccaggttcagattctggcagcgattctaattcagatagcggttcagat
tcgggtagtgattctacatcagatagtggttcagattcagcgagtgattcagattcagca
agtgattcagactcagcgagtgattcagattcagcaagcgattccgactcagcgagcgat
tccgactcagacaatgactcggattcagatagcgattctgactcagacagtgactcagat
tccgacagtgactcagattcagatagcgattctgactcagacagtgactcagattcagat
agcgattcagattcagatagcgattcagattccgacagtgattccgactcagacagcgat
tctgactccgacagtgattccgactcagacagcgattcagattccgacagtgattccgac
tcagatagcgattccgactcagatagcgactcagattcagacagcgattcagattcagac
agcgattcagattcagatagcgattcagattccgacagtgactcagattccgacagtgac
tcggattcagatagcgattcagattccgacagtgactcagattccgacagtgactcagac
tcagacagtgattcggattcagcgagtgattcggattcagatagtgattccgactccgac
agtgactcggattcagatagcgactcagactcggatagcgactcggattcagatagcgat
tcggactcagatagcgattcagaatcagacagcgattcagaatcagacagcgattcagat
tcagacagcgactcagacagtgactcagattcagatagtgactcggattcagcgagtgat
tcagactcaggtagtgactccgattcatcaagtgattccgactcagaaagtgattcaaat
agcgattccgagtcaggttctaacaataatgtagttccgcctaattcacctaaaaatggt
actaatgcttctaataaaaatgaggctaaagatagtaaagaaccattaccagatacaggt
tctgaagatgaagcaaatacgtcactaatttggggattattagcatcaataggttcatta
ctacttttcagaagaaaaaaagaaaataaagataagaaataa

DBGET integrated database retrieval system