KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_0932Help
Entry
NWMN_0932         CDS       T00557                                 

Gene name
folD
Definition
(GenBank) FolD bifunctional protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00670  One carbon pool by folate
sae01100  Metabolic pathways
sae01120  Microbial metabolism in diverse environments
sae01200  Carbon metabolism
Module
sae_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NWMN_0932 (folD)
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     NWMN_0932 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     NWMN_0932 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAF67204
UniProt: A6QFS2
Position
complement(1035034..1035894)
Genome map
AA seq 286 aa AA seqDB search
MVAKILDGKQIAKDYRQGLQDQVEALKEKGFTPKLSVILVGNDGASQSYVRSKKKAAEKI
GMISEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVD
GFHPINIGKLYIDEQTFVPCTPLGIMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQ
KNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVGNTPDENGKLK
GDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggttgctaaaattttagatggtaaacaaattgccaaagactacagacaggggttacaa
gatcaagttgaagcgctaaaagaaaagggttttacacctaaattatccgttatattagtt
ggtaatgatggcgctagtcaaagttatgttagatcaaaaaagaaagcagctgaaaaaatt
ggtatgatttcagaaatcgtacatttggaagaaacagctactgaagaagaagtattaaac
gaactaaatagactaaataatgatgattctgtaagtggtattttggtacaagtaccatta
ccaaaacaagttagcgaacagaaaatattagaagcaatcaatcctgaaaaagatgtggac
ggttttcatccaataaatatagggaaattatatatcgatgaacaaacttttgtaccttgc
acaccgctcggcatcatggaaatattaaaacatgctgatattgatttagaaggtaaaaat
gcagttgtaattggacgaagtcatattgtcggacaaccagtttctaagttactacttcaa
aaaaatgcatcagtaacaatcttacattctcgttcaaaagatatggcatcatatttaaaa
gatgctgatgtcattgtcagtgcagttggtaagcctggtttagtaacaaaagatgtggtc
aaagaaggagcagtaattatcgatgttggcaatacgccagatgaaaatggcaaattaaaa
ggtgacgttgattatgatgcggttaaagaaattgctggagctattacaccagttcctggt
ggcgttggtccattaacaattactatggtattaaataatactttgcttgcagaaaaaatg
cgtcgaggtattgattcgtaa

DBGET integrated database retrieval system