KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1005
Entry
NWMN_1005         CDS       T00557                                 

Definition
(GenBank) endodeoxyribonuclease
Organism
sae  Staphylococcus aureus subsp. aureus Newman
SSDB
Motif
Pfam: RusA
Other DBs
NCBI-ProteinID: BAF67277
UniProt: A0A0H3KC64
Position
1110575..1110982
AA seq 135 aa
MEIEIKFNETFEAPMGSPRPRFRNTGRFVQTYMPTAYTNHKAYIQGQMPKLNLERALKIE
LDFYFPLLKSWSKKKKSEMVGQYKVTKPDIDNLIKTVLDACNGHVWKDDNQITEITSSKR
YGLEPKIIMRVEEVI
NT seq 408 nt   +upstreamnt  +downstreamnt
atggaaatagaaattaaatttaacgaaacgttcgaggcacctatgggctcgcctcgtcca
cgctttcgtaatacaggtagatttgttcaaacatacatgccaacagcttatacaaatcat
aaagcgtatatacaagggcaaatgcctaagttaaatctagagcgcgcactaaaaatcgaa
ttagacttttactttccattacttaaatcatggtcgaagaaaaagaaaagtgaaatggtt
ggacagtataaagtgactaagccggatatcgataacttaattaaaacagtattagacgca
tgtaatggtcatgtgtggaaagacgataaccaaattacagaaataactagctcaaagcgt
tatggactagaaccaaaaataatcatgcgagttgaggaagtgatctaa

DBGET integrated database retrieval system