KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_1561
Entry
NWMN_1561         CDS       T00557                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00860  Porphyrin and chlorophyll metabolism
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01120  Microbial metabolism in diverse environments
sae01240  Biosynthesis of cofactors
Module
sae_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
sae_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NWMN_1561 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sae01007]
    NWMN_1561 (hemL)
Enzymes [BR:sae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     NWMN_1561 (hemL)
Amino acid related enzymes [BR:sae01007]
 Aminotransferase (transaminase)
  Class III
   NWMN_1561 (hemL)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: BAF67833
UniProt: A6QHK1
Position
complement(1727560..1728846)
AA seq 428 aa
MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLS
WGPLILGHRDPQVISHLHEAIDKGTSFGASTLLENKLAQLVIDRVPSIEKVRMVSSGTEA
TLDTLRLARGYTGRNKIVKFEGCYHGHSDSLLIKAGSGVATLGLPDSPGVPEGIAKNTIT
VPYNDLDALKIAFEKFGNDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDE
VMTGFRVGYHCAQGYFGVTPDLTCLGKVIGGGLPVGAFGGKKEIMDHIAPLGNIYQAGTL
SGNPLAMTSGYETLSQLTPETYEYFNMLGDILEDGLKRVFAKHNVPITVNRAGSMIGYFL
NEGPVTNFEQANKSDLKLFAEMYREMAKEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFD
TALSRIVK
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgagatatacgaaatcagaagaagcaatgaaggttgctgaaactttaatgcctggtggt
gtaaatagtccagtacgcgcatttaaatcagtagatacaccagcaatttttatggatcac
ggtaaaggttcaaaaatttatgatatcgatggtaacgagtatatcgactatgtactaagt
tggggaccacttattttaggacatagagaccctcaagttattagtcatttacatgaagca
attgataaaggtacaagttttggtgcatcaacattacttgaaaataaattggcgcagctc
gttattgaccgagtaccttcaatagaaaaagtgcgtatggtgtcatctggtacagaagct
acattggatactttaagattagcacgtggttatactggcagaaataaaattgtgaaattt
gaaggttgctatcatggtcatagtgattcgttattaatcaaagctggttctggggtggca
acattaggattgccggattctcctggtgtgcctgaaggtattgctaaaaatacaattaca
gttccatacaatgatttagatgcacttaaaatcgctttcgaaaaatttggaaacgatatt
gctggtgtaatcgtagaacctgttgctggtaatatgggtgtcgtaccgccgattgaaggt
tttttacagggattaagagatattacgactgaatacggcgcattgctaattttcgatgaa
gtaatgactggtttcagagtcggttatcattgtgcacaaggttactttggtgtgacacca
gatttaacttgcttaggaaaagttatcggtggaggactacctgtaggtgcatttggtggt
aaaaaagaaatcatggatcatatagcaccattaggaaatatttatcaagcgggtacgtta
tcaggaaatcctcttgcaatgacaagtggttatgaaacgttaagccaattaacgccagag
acatatgagtattttaatatgttaggcgatatacttgaagacggtttaaaacgtgtattt
gctaaacacaatgtaccaataactgtaaatagagcaggttcaatgattggttatttctta
aatgaaggacctgtaactaattttgaacaagcgaataaaagtgatttgaaattatttgca
gaaatgtatcgagaaatggcaaaagaaggtgtgtttttaccaccatctcaatttgaaggt
acattcttatctacggcacacacgaaagaagatattgaaaaaacgattcaagcatttgat
acggctttaagtcgtattgtaaaataa

DBGET integrated database retrieval system