KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2499Help
Entry
NWMN_2499         CDS       T00557                                 

Gene name
ldh
Definition
(GenBank) L-lactate dehydrogenase 2
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00010  Glycolysis / Gluconeogenesis
sae00270  Cysteine and methionine metabolism
sae00620  Pyruvate metabolism
sae00640  Propanoate metabolism
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01120  Microbial metabolism in diverse environments
sae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NWMN_2499 (ldh)
   00620 Pyruvate metabolism
    NWMN_2499 (ldh)
   00640 Propanoate metabolism
    NWMN_2499 (ldh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NWMN_2499 (ldh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sae04147]
    NWMN_2499 (ldh)
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     NWMN_2499 (ldh)
Exosome [BR:sae04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   NWMN_2499 (ldh)
  Exosomal proteins of breast milk
   NWMN_2499 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Sacchrp_dh_NADP UDPG_MGDP_dh_N NAD_binding_7 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: BAF68771
UniProt: A6QK89
Position
complement(2743830..2744789)
Genome map
AA seq 319 aa AA seqDB search
MKTFGKKVVLIGDGSVGSSYAFAMVTQGVADEFVIIDIAKDKVKADVQDLNHGTVHSPSP
VDVKAGEYEDCKDADLVVITAGAPQKPGETRLQLVEKNTKIMKSIVKSVMDSGFDGYFLI
AANPVDILTRFVKEYTGLPAERVIGSGTVLDSARLQYLISQELGVAPSSVDASIIGEHGD
TELAVWSQANVAGISVYDTLKEQTGSEAKAEEIYVNTRDAAYEIIQAKGSTYYGIALALM
RISKAILNNENNVLNVSIQLDGQYGGHKGVYLGVPTLVNQHGAVKIYEMPLSAEEQALFD
KSVKTLEDTFDSIKYLLED
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttggtaaaaaggttgtattaatcggagatggatctgtaggatcaagctat
gcctttgcaatggttacgcaaggtgttgctgatgaatttgtaattattgacattgcaaaa
gacaaagtaaaagcagatgttcaagatttaaaccatggtacagtccacagtccttcacca
gttgatgtgaaagcaggtgaatacgaagactgtaaagatgcagatttagttgttattaca
gctggtgcacctcaaaagccaggtgaaacacgtttacaattagttgaaaaaaatactaag
attatgaagagcatcgttaagagtgttatggatagtggctttgatggatatttcttaatc
gcggcaaaccctgtagacattttaacaagatttgtaaaagaatatactggattaccagca
gagcgtgttatcggttcaggtactgtattggacagtgcacgtttacaatatttaattagc
caagaacttggtgttgcaccttcaagtgttgacgctagtattattggcgagcatggtgat
actgaacttgcagtttggtcacaagcaaatgtagcaggtatttcagtatatgacacatta
aaagaacaaactggtagcgaagctaaagcggaagaaatttatgtgaatacacgtgacgct
gcttatgaaattatccaagctaaagggtcaacatactatggtattgcattagcattgatg
cgcatttcaaaagccattttaaataatgaaaataatgtcttaaatgtttctatacaatta
gatggtcaatatggtggtcacaaaggcgtttacctaggtgtaccaacattagttaaccaa
catggcgcagttaaaatttatgaaatgccattaagtgccgaagaacaagcgttgttcgat
aaatctgttaaaacattagaagatacatttgattcaattaaatatttattagaagactaa

DBGET integrated database retrieval system