KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2504Help
Entry
NWMN_2504         CDS       T00557                                 

Definition
(GenBank) malate:quinone oxidoreductase 2
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Pathway
sae00020  Citrate cycle (TCA cycle)
sae00620  Pyruvate metabolism
sae01100  Metabolic pathways
sae01110  Biosynthesis of secondary metabolites
sae01120  Microbial metabolism in diverse environments
sae01130  Biosynthesis of antibiotics
sae01200  Carbon metabolism
Module
sae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NWMN_2504
   00620 Pyruvate metabolism
    NWMN_2504
Enzymes [BR:sae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NWMN_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAF68776
UniProt: A0A0H3KJ25
Position
complement(2750223..2751719)
Genome map
AA seq 498 aa AA seqDB search
MAKSNSKDIVLIGAGVLSTTFGSMLKEIEPDWNIHVYERLDRPAIESSNERNNAGTGHAA
LCELNYTVLQPDGSIDIEKAKVINEEFEISKQFWGHLVKSGSIENPREFINPLPHISYVR
GKNNVKFLKDRYEAMKAFPMFDNIEYTEDIEVMKKWIPLMMKGREDNPGIMAASKIDEGT
DVNFGELTRKMAKSIEAHPNATVQFNHEVVDFEQLSNGQWEVTVKNRLTGEKFKQVTDYV
FIGAGGGAIPLLQKTGIPESKHLGGFPISGQFLACTNPQVIEQHDAKVYGKEPPGTPPMT
VPHLDTRYIDGQRTLLFGPFANVGPKFLKNGSNLDLFKSVKTYNITTLLAAAVKNLPLIK
YSFDQVIMTKEGCMNHLRTFYPEARNEDWQLYTAGKRVQVIKDTPEHGKGFIQFGTEVVN
SQDHTVIALLGESPGASTSVSVALEVLERNFPEYKTEWAPKIKKMIPSYGESLIEDEKLM
RKIRKQTSKDLELGYYEN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtctaatagtaaagacatcgttttaattggagccggtgtacttagcacaaca
tttggttcaatgttaaaagaaattgagccagactggaatatccacgtttacgaacgcttg
gatcgtcctgcaatcgaaagttcaaacgaaagaaataatgctggtacgggtcatgcagca
ttatgtgagttgaactacacagttttacaacctgatggttctatcgacatcgaaaaagcg
aaagtgattaacgaagagtttgagatttcaaaacaattctggggtcacttagtgaaaagc
ggtagcatcgagaacccaagagaatttatcaatccattaccacacatcagttatgttaga
ggtaaaaacaatgttaaattcttaaaagatcgttacgaagcgatgaaagctttccctatg
ttcgataatatcgaatatactgaagacatcgaagtaatgaaaaaatggattccattgatg
atgaaaggccgtgaagataaccctggtatcatggcggcaagtaaaattgacgaaggtaca
gatgtaaacttcggtgaattaacacgtaaaatggctaaaagcattgaagcacatccaaat
gctacagtgcaatttaaccatgaagttgttgattttgaacaattatcaaatggtcaatgg
gaagttactgttaaaaatcgcctaactggtgagaaattcaaacaagtaactgactacgta
ttcatcggtgctggcggtggagcaattccattattacaaaaaacaggtatccctgaaagt
aaacatttgggtggattccctatcagtggtcaattcttagcttgtacaaacccacaagtt
attgaacaacacgatgccaaagtttatggtaaagagccacctggtacaccaccaatgact
gtacctcatttagatacgcgttacattgatggtcaaagaacattattatttggaccattt
gctaatgttggacctaaattcttgaaaaatggttctaacttagatttattcaagtctgtt
aaaacatacaacattacaactttattagcagcagcagttaaaaacttacctttaattaaa
tactcatttgaccaagtaattatgacaaaagaaggttgtatgaaccacttacgtactttc
tatccagaagcacgtaatgaagattggcaattatacactgctggtaaacgtgtacaagtt
atcaaagatacacctgaacacggtaaaggattcatccaattcggtacagaagtggttaac
tcacaagaccacactgtaattgcattattaggtgaatcaccaggggcttcaacttcagtt
tcagttgcgttagaagtattagaacgtaacttccctgaatacaaaactgaatgggcacct
aaaattaagaaaatgattccatcatacggtgaatcattaattgaagacgaaaaattaatg
agaaaaatccgtaaacaaacttcaaaagacttagaattaggttactacgaaaactaa

DBGET integrated database retrieval system