KEGG   Sulfurihydrogenibium azorense: SULAZ_0216Help
Entry
SULAZ_0216        CDS       T00876                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00900  Terpenoid backbone biosynthesis
saf01100  Metabolic pathways
saf01110  Biosynthesis of secondary metabolites
saf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SULAZ_0216 (ispE)
Enzymes [BR:saf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SULAZ_0216 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACN98505
UniProt: C1DXV1
Position
190179..191012
Genome map
AA seq 277 aa AA seqDB search
MEVLLSPAKVNIGLWIVEKRDDGYHNIFSFFHTIDLYDRIYIKPSHTLTVKSSTLDPDLQ
EEKNIVYKTVTLFEKTTGIDQNWEIFIEKNIPVGGGLGGGSSNAAVVLQFLNSFYKNPLS
EKDLFDLSVKIGADAPFFLKGGFALAQGIGEKLTFFDQRLNDELFLIYPNIKSNTGEVYS
KVDKNMLTNKDDLNIILNLITEYGTKKIFEVAENKLGEIAKKIYPEIEEVYNFLEYLGYK
PFITGSGSTVYCVGSPSKEVETACKVRNWKLIKTRFK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaagtactgctttcaccggcaaaagttaatataggtctatggatagtagaaaaaagg
gatgatggataccataacatattttctttttttcacacaatagatttatacgacaggata
tacataaaaccctcacacactctaactgtaaaaagttctacattagaccctgatttacag
gaagaaaagaacatagtttataaaacagttactttatttgaaaagactaccggaatagac
caaaactgggagatttttatagaaaaaaatattccagtaggtggtgggcttggtggtggt
agttctaacgcagctgtagttttacagtttttaaacagtttctataaaaatcctctttca
gaaaaagacctttttgacctatcagttaaaataggggctgatgctccatttttccttaaa
ggtggttttgctctggctcaagggataggagagaagctaacattctttgaccaaagactt
aatgatgaattgtttttaatctaccctaatattaaatcaaacacaggtgaagtttactca
aaagttgataaaaatatgttgacaaacaaagatgatttgaatataatattaaatctgata
actgaatacggtactaaaaagatttttgaagttgcagaaaataagttaggtgaaatagct
aaaaagatataccctgaaattgaggaagtttacaacttcttagagtatttaggttataag
ccttttataacgggaagtggtagcacagtttactgtgtaggtagcccttcaaaagaagta
gagactgcctgtaaagttagaaattggaaattgattaaaacaagattcaaataa

DBGET integrated database retrieval system