KEGG   Sulfurihydrogenibium azorense: SULAZ_0951Help
Entry
SULAZ_0951        CDS       T00876                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
saf  Sulfurihydrogenibium azorense
Pathway
saf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saf01100  Metabolic pathways
saf01110  Biosynthesis of secondary metabolites
saf01130  Biosynthesis of antibiotics
saf01230  Biosynthesis of amino acids
Module
saf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SULAZ_0951 (trpC)
Enzymes [BR:saf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SULAZ_0951 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: ACN99210
UniProt: C1DUY7
Position
876487..877269
Genome map
AA seq 260 aa AA seqDB search
MNILEKIIQTKKQELENYNDKYVKHLESLSLERKKKVLDFKKALKGKDINIIAEVKKASP
SKGVIRHDFDPLTIAKIYEENGAKAISVLTDKQYFQGSIEYLYNISKEVKLPLLRKDFII
DKRQILEAYAYGADSYLLIAKVLTLQEIKEFINFGKELGMEPLVEIHSYDEGVKSLYAGA
VIIGINNRSLETFEVDINLSKQLAPKMKELGAEVVVAESGLNTKQELLELKNYQVDAFLI
GESLMRERDIGKKLRVLTAS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttagaaaagattattcaaacaaagaaacaagaacttgaaaattacaacgat
aagtatgtaaaacacttagaaagtctttctttagaaagaaagaaaaaagtccttgatttt
aaaaaagctttaaaaggtaaagacattaacataattgcagaagtaaaaaaagcatctcct
tcaaaaggtgtaataagacacgactttgacccactgactatagccaagatttacgaagaa
aacggtgcaaaggctatatccgttttaacagataaacagtactttcaaggaagcatagag
tacctgtacaacatctcaaaagaagtaaaacttccactactgagaaaagactttataata
gacaaaagacagatattagaagcttacgcctacggagctgacagttatcttcttattgca
aaagtcttaactcttcaagagataaaagaatttataaattttggtaaagagctgggaatg
gagcctcttgttgagatacactcttacgatgaaggtgtaaaatctctttatgcaggagct
gtaataataggcatcaacaacagaagtttagaaacatttgaagtagatataaacctttca
aaacaacttgcacctaaaatgaaagaacttggagctgaagttgtagtagcagaaagtggt
ctaaatacaaaacaagaacttttagagttgaaaaattatcaagtagatgcatttttaata
ggagaatcccttatgagggaaagagatatagggaaaaagttaagggtgttaacagcatct
tga

DBGET integrated database retrieval system