KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0545
Entry
SAG0545           CDS       T00091                                 
Name
(GenBank) prophage LambdaSa1, site-specific recombinase, phage integrase family
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_5 U62_UL91
Other DBs
NCBI-ProteinID: AAM99446
UniProt: Q8E120
Position
complement(558826..559905)
AA seq 359 aa
MWIEELANGKFKYIERYTDPLTNKYKKVSVTLDKNSSQAQKKAGLILQEKIEDRLAIRNH
SEMTYGELKKEYLKQWIPTVKDSTKRGYLVSDSHIATVLPDDTIINKLTKRDIRLIIDKL
LKHNSYHVTHKCRKRLHAIFSYAIQMDYMTSNPTENVLVPKPKDDYKPEKVLYLTSNEVY
DLCNRMIDNDEQTLADIVLFMFLTGVRYGELSCLTYDKIDFENKEILINATYDFNTREIT
TTKTKKSTRKISVSDNILDIVNRQKKTSSFVFPNSNGVPILNAYINKRLKIYGDYHTHLF
RHSHISFLAEKGIPLNAIMDRVGHSDPKTTLSIYSHTTVNMKEIINKQTAPFVPLLKSE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtggatagaggagctagccaacgggaaatttaaatatatcgaaagatatactgaccct
ctaacaaataagtacaaaaaagtatctgtgacactagataaaaattctagtcaagctcag
aaaaaagctggtttaatattgcaggaaaagattgaagataggctcgctatcagaaatcac
tcagaaatgacttacggagaacttaaaaaggaatatctaaagcaatggataccgaccgtc
aaagactccacaaaacgtggttatttagtatctgacagtcatatagcaaccgtgttacca
gatgatacaattatcaacaagttgactaaacgtgatattagactaatcattgataaacta
ttaaaacacaattcgtatcatgttacgcataaatgtagaaagagattgcatgccatattt
tcttatgcgatacaaatggactatatgacaagtaatccgacggagaacgtcttagttccc
aaaccaaaggatgattacaagcctgaaaaggtgctttatttaacatctaacgaggtttac
gacctgtgcaatagaatgatagacaatgacgaacaaacgctcgcagacatcgttttattc
atgtttttgacgggtgtacggtatggagaattatcttgtctgacttacgacaaaatagat
tttgaaaataaagaaattctgattaatgcaacttacgattttaacacacgagaaatcact
acgaccaagaccaaaaaatcaacacgcaaaatatctgtatcagataatattttagatatc
gtcaatagacagaaaaagacaagttcattcgtctttccaaattcgaacggtgtaccgatt
ttaaacgcgtacatcaataagcgattgaaaatttatggagattatcacacgcacttattt
agacactcgcatatatcatttttagcagaaaaagggataccgctaaatgcgataatggat
agagttggtcacagcgatccaaaaacaacattatctatttacagtcacacaactgtaaat
atgaaagaaattataaataaacaaactgccccttttgtgccccttttaaaatcggaataa

DBGET integrated database retrieval system