KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0550
Entry
SAG0550           CDS       T00091                                 
Name
(GenBank) conserved hypothetical protein
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
SSDB
Motif
Pfam: DUF2188
Other DBs
NCBI-ProteinID: AAM99451
UniProt: Q8E115
Position
complement(562191..562415)
AA seq 74 aa
MAKNQHVVPNPNGGWDIKGAGNSRATKHTTTQAEAVEIATGIAKNNSSEVIIHGKNGRIR
ERNSYGNDPFPPKG
NT seq 225 nt   +upstreamnt  +downstreamnt
atggctaaaaatcaacatgtcgtacctaaccctaatggcggttgggatataaaaggtgca
ggcaacagtcgtgcgaccaaacacacaacaacccaagccgaagctgtcgaaatcgctact
ggtatcgctaaaaacaatagcagtgaagttattatccatggcaaaaatggacgaattcgc
gaacgtaacagctatggtaacgatccattcccacctaaaggttag

DBGET integrated database retrieval system