KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0554
Entry
SAG0554           CDS       T00091                                 
Name
(GenBank) prophage LambdaSa1, transcriptional regulator, Cro/CI family
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26 HTH_37 HTH_11 HTH_25 MarR HTH_24 Sigma70_r4 IF2_N
Other DBs
NCBI-ProteinID: AAM99455
UniProt: Q8E111
Position
563691..563882
AA seq 63 aa
MQQFNLKQLREKKGFTQNELADKANVSRSLVVGLETGSYSETSTASLKKLAKALDVKIKD
LFF
NT seq 192 nt   +upstreamnt  +downstreamnt
atgcaacaatttaatctaaaacaactacgagagaaaaaaggatttactcaaaatgaatta
gctgataaagctaacgttagtcgttcgctcgtggttggtttagaaacaggttcatattca
gagacatctacagcatctctgaagaaattggcgaaagctttggacgtaaagattaaggat
ttatttttttaa

DBGET integrated database retrieval system