KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0555
Entry
SAG0555           CDS       T00091                                 
Name
(GenBank) prophage LambdaSa1, antirepressor, putative
  KO
K07741  anti-repressor protein
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Brite
KEGG Orthology (KO) [BR:sag00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    SAG0555
SSDB
Motif
Pfam: ANT AntA
Other DBs
NCBI-ProteinID: AAM99456
UniProt: Q8E110
Position
563950..564699
AA seq 249 aa
MNQLINITLNENQEPVVSGRDLHNVLNIKTQYTKWLERMSEYGFEENVDYIAISQKRLTA
QGNRTEYIDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQVEKDFNSPEKIMARALLMADKK
ITNLTMENNQLQLDLKEAQKQARYLDLIIESKGALRVTQIAADYGMSVNKFNKTLLEFGV
QHKVNGQWILYKRHMGKGYTDSHTFDYQDKNGHTRANVTTTWTQKGRLFLYELLKDNNIL
PLIEQEDIV
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaatcaactaataaacatcaccctaaacgaaaatcaagaaccagttgtcagtggtaga
gatttacacaatgtacttaatataaaaactcaatatactaaatggcttgaaaggatgtcg
gaatatggttttgaagaaaacgttgactatatagctattagtcaaaaaagactaacagct
caaggtaaccgtacagaatatatagaccacgttctcaagctagacatggcaaaagagatt
gctatgttacagcgaaacgagaaatcaaaacaggtacgcaaatacttcatccaggttgaa
aaagacttcaatagtcctgagaaaatcatggcgagagccttgctcatggcagataagaaa
atcactaacttaacgatggaaaataatcaattgcagttagatttaaaagaagctcaaaag
caagcgcgttatcttgatctaatcattgagagcaagggagctttgcgagtaacacagatt
gctgctgattatggtatgtctgtcaataaattcaataaaacactattagaatttggtgtg
cagcacaaagtgaatggacaatggattctctataaacgacatatgggcaaaggttacaca
gacagtcacacatttgactatcaagacaaaaacggccatacaagagccaatgtgacgacg
acgtggacacaaaaggggcgtctattcctgtacgagttgttgaaagacaacaatattttg
ccactaattgaacaggaagacattgtatag

DBGET integrated database retrieval system