KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0563
Entry
SAG0563           CDS       T00091                                 
Name
(GenBank) hypothetical protein
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
SSDB
Motif
Pfam: DivIC IFP_35_N
Other DBs
NCBI-ProteinID: AAM99464
UniProt: Q8E102
Position
567086..567247
AA seq 53 aa
MNEEIYESSRYWQSRYSDLMSDYLKEAEENIELKKQLKRLKAENWQLKHRKRK
NT seq 162 nt   +upstreamnt  +downstreamnt
gtgaacgaagaaatatatgagtctagtcgttactggcaaagtagatacagcgacttgatg
tctgattatcttaaagaagctgaagaaaatatagagttaaagaaacagttgaagagatta
aaagccgaaaattggcagctgaaacacagaaagaggaaatga

DBGET integrated database retrieval system