KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0566
Entry
SAG0566           CDS       T00091                                 
Symbol
ssb-2
Name
(GenBank) prophage LambdaSa1, single-strand binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag03030  DNA replication
sag03430  Mismatch repair
sag03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAG0566 (ssb-2)
   03430 Mismatch repair
    SAG0566 (ssb-2)
   03440 Homologous recombination
    SAG0566 (ssb-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sag03032]
    SAG0566 (ssb-2)
   03400 DNA repair and recombination proteins [BR:sag03400]
    SAG0566 (ssb-2)
   03029 Mitochondrial biogenesis [BR:sag03029]
    SAG0566 (ssb-2)
DNA replication proteins [BR:sag03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAG0566 (ssb-2)
DNA repair and recombination proteins [BR:sag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     SAG0566 (ssb-2)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SAG0566 (ssb-2)
Mitochondrial biogenesis [BR:sag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SAG0566 (ssb-2)
SSDB
Motif
Pfam: SSB tRNA_anti-codon Phage_SSB tRNA_anti_2 PAZ
Other DBs
NCBI-ProteinID: AAM99467
UniProt: Q8E0Z9
Position
568399..568815
AA seq 138 aa
MINNIVLVGRMTKDAELRYTPSNQAVATFSLAVNRNFKNQSGEREADFINCVIWRQQAEN
LANWAKKGALVGITGRIQTRNYENQQGQRIYVTEVVAENFQLLESRNSQQQTNQSGNSSN
SYFGNANKMDISDDDLPF
NT seq 417 nt   +upstreamnt  +downstreamnt
atgattaacaacattgtactagtaggtcgcatgaccaaggatgccgaacttcgttataca
ccaagtaatcaagcggtagctactttttcacttgcagttaatcgtaattttaaaaatcaa
tctggcgaacgtgaggctgattttattaactgtgttatttggcgccaacaagctgaaaac
ttggctaactgggcaaaaaaaggtgctttggttggaattacaggtcgtatccaaacgcgt
aattatgaaaaccaacaaggtcaacgtatctatgtaacagaagttgttgcggaaaatttc
caattattagaaagtcgcaatagccaacaacagactaatcaaagcggcaatagttctaat
tcttattttggcaatgccaacaaaatggatatttcagatgatgacttaccattctga

DBGET integrated database retrieval system