KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0406Help
Entry
SAG0406           CDS       T00091                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00040  Pentose and glucuronate interconversions
sag00052  Galactose metabolism
sag00500  Starch and sucrose metabolism
sag00520  Amino sugar and nucleotide sugar metabolism
sag01100  Metabolic pathways
sag01130  Biosynthesis of antibiotics
Module
sag_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAG0406 (galU)
   00052 Galactose metabolism
    SAG0406 (galU)
   00500 Starch and sucrose metabolism
    SAG0406 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SAG0406 (galU)
Enzymes [BR:sag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAG0406 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 1013201
NCBI-ProteinID: NP_687440
UniProt: Q8E1E9
Position
complement(413270..414169)
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSK
RSIEDHFDSNFELEYNLKEKGKNELLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFVG
NEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVMEVPHEDVSAYGVIAPQGE
GVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTL
NKTQRVFARKFTGDRYDVGDKFGFMKTSIDYALQHPQVKDDLKKYIIDLGKSLEKTSKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcagttatccctgccgctggtttaggaacacgttttttacctgct
actaaagctttagctaaagaaatgcttccaatcgttgataaaccaactattcaatttatt
gttgaagaagcactaaaatctggaattgaagatattttagttgtaactggtaaatcaaaa
cgttctatagaagaccactttgattcaaattttgaattagaatataacctaaaagagaaa
gggaaaaacgaacttctcaaacttgttgatgaaacaactggcattcgactccattttatt
cgacaaagtcatcctcgtgggcttggagatgctgtgctacaagcaaaagccttcgttggt
aatgaaccttttgttgttatgctaggtgatgatctaatggatattaccaataataaagtt
attcctctcaccaaacaattaattaatgactttgaagctactcatgcatcaacaattgct
gttatggaagttccacatgaagatgtttctgcttatggtgttattgctccacaaggagaa
ggagttaatggtctatatagcgttaacactttcgttgaaaaaccttctcccgaagaggct
ccaagtaatttggcaatcattggtcgctacttgttaactccagaaatttttaatatttta
gaaactcaaaaacctggtgcaggaaatgagattcaactaaccgatgctatcgatacttta
aataaaacgcaacgtgtttttgctagaaaatttacaggagaccgttacgacgttggtgac
aagtttggttttatgaaaacatctattgattatgctcttcaacacccacaagttaaagat
gacttgaagaaatatatcattgatttaggaaaatctctagaaaaaacatctaagaagtaa

DBGET integrated database retrieval system