KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0466Help
Entry
SAG0466           CDS       T00091                                 

Definition
(RefSeq) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00071  Fatty acid degradation
sag00072  Synthesis and degradation of ketone bodies
sag00280  Valine, leucine and isoleucine degradation
sag00310  Lysine degradation
sag00362  Benzoate degradation
sag00380  Tryptophan metabolism
sag00620  Pyruvate metabolism
sag00630  Glyoxylate and dicarboxylate metabolism
sag00640  Propanoate metabolism
sag00650  Butanoate metabolism
sag00900  Terpenoid backbone biosynthesis
sag01100  Metabolic pathways
sag01110  Biosynthesis of secondary metabolites
sag01120  Microbial metabolism in diverse environments
sag01130  Biosynthesis of antibiotics
sag01200  Carbon metabolism
sag01212  Fatty acid metabolism
sag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAG0466
   00630 Glyoxylate and dicarboxylate metabolism
    SAG0466
   00640 Propanoate metabolism
    SAG0466
   00650 Butanoate metabolism
    SAG0466
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAG0466
   00072 Synthesis and degradation of ketone bodies
    SAG0466
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAG0466
   00310 Lysine degradation
    SAG0466
   00380 Tryptophan metabolism
    SAG0466
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAG0466
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAG0466
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAG0466
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sag04147]
    SAG0466
Enzymes [BR:sag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAG0466
Exosome [BR:sag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAG0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-GeneID: 1013269
NCBI-ProteinID: NP_687496
UniProt: Q8E195
Position
480332..481447
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGTLAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttatgctaaagaagataatcgtaacggagaatatacagttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctctattt
aatcattattatcctgaagagagagaaaaattcaatatttttggagggacattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system