KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0763Help
Entry
SAG0763           CDS       T00091                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00010  Glycolysis / Gluconeogenesis
sag00051  Fructose and mannose metabolism
sag00562  Inositol phosphate metabolism
sag01100  Metabolic pathways
sag01110  Biosynthesis of secondary metabolites
sag01120  Microbial metabolism in diverse environments
sag01130  Biosynthesis of antibiotics
sag01200  Carbon metabolism
sag01230  Biosynthesis of amino acids
Module
sag_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sag_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAG0763 (tpiA)
   00051 Fructose and mannose metabolism
    SAG0763 (tpiA)
   00562 Inositol phosphate metabolism
    SAG0763 (tpiA)
Enzymes [BR:sag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAG0763 (tpiA)
Exosome [BR:sag04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAG0763 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAG0763 (tpiA)
  Exosomal proteins of melanoma cells
   SAG0763 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1013567
NCBI-ProteinID: NP_687778
UniProt: Q8E0H0
Position
758981..759739
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSEL
KIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaataaaaatccagaagaagca
aaagcattcatcgaagcagtagcttctaaattaccatcatcagaacttgttgaagcaggg
attgctgctccagcgcttactttatcaacagttcttgaagcagctaaaggttcagaattg
aaaatcgctgctcaaaatagctattttgagaattcaggtgcattcactggtgaaaacagc
cctaaagtattggctgaaatgggtacagactacgttgttatcggtcactcagaacgtcgt
gattatttccatgaaactgaccaagatatcaacaaaaaagcaaaagctatctttgctaat
ggtttgactccaatcatttgttgcggtgagtctcttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttcagcagctcttgcaggtttgtcagaagagcaagta
tcatcacttgttatcgcttacgaaccaatctgggctattggtactggtaaatcagcaact
caagacgacgcacaaaacatgtgtaaagcagttcgtgacgttgttgcagcagacttcggt
caagcagttgctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagaatatatggcttgcccagacgttgacggtgcccttgtaggtggagcttcacttgaa
gcagaaagcttccttgccttattagattttgttaaataa

DBGET integrated database retrieval system