KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0866Help
Entry
SAG0866           CDS       T00091                                 

Gene name
murA-2
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00520  Amino sugar and nucleotide sugar metabolism
sag00550  Peptidoglycan biosynthesis
sag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAG0866 (murA-2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAG0866 (murA-2)
Enzymes [BR:sag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SAG0866 (murA-2)
Peptidoglycan biosynthesis and degradation proteins [BR:sag01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SAG0866 (murA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 1013670
NCBI-ProteinID: NP_687880
UniProt: Q8E069
Position
866055..867326
Genome map
AA seq 423 aa AA seqDB search
MDKIIVEGGQTQLQGQVVIEGAKNAVLPLLAATILPSQGKTLLTNVPILSDVFTMNNVVR
GLDIQVDFNCDKKEILVDASGDILDVAPYEFVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGATITQNGGDITAQAEKLKGANIYMDFPSVGATQNLMMAATLA
SGTTTIENAAREPEIVDLAQLLNKMGAKVKGAGTETLTIIGVDALHGTEHDVVQDRIEAG
TFMVAAAMTSGNVLVKDAIWEHNRPLISKLMEMGVEVSEEEDGIRVKADTKKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMIETVFENRFQHLEEMRRMGLQTEILRDTAMIHG
GRALQGAPVMSTDLRASAALILAGMVAQGQTVVGQLTHLDRGYYQFHEKLAALGANIKRV
SEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattgtggaaggtgggcaaacgcagcttcaaggtcaagttgttattgaa
ggagctaaaaatgcagttttacctcttttagcagccacaattttaccaagccaagggaaa
acattgttgaccaatgttcctatcttgtctgatgtatttacaatgaacaatgttgttcgt
ggtttagatattcaagttgactttaattgcgataaaaaagaaatcttagtggatgcctca
ggtgatattttagatgttgcaccttatgaatttgttagtcaaatgagagcttctattgtt
gttttgggacctattttagctagaaatggccatgctaaggtttcaatgccaggcggttgt
acaattggtagccgaccaattgaccttcatcttaaaggtttagaagctatgggagctacg
attacacaaaatggtggtgatattactgcccaagctgaaaagcttaagggagctaatata
tacatggattttccctcagtcggtgccactcaaaacttaatgatggctgctacacttgct
tcaggcacaacaacgatagagaatgctgcacgtgaaccagaaattgtagaccttgcgcag
ttactaaataaaatgggagctaaagtaaagggtgctggtacggaaacattaacgatcatt
ggtgttgatgctttacatggtacagaacatgatgttgtccaagatcgtattgaagctgga
acctttatggtggcagctgctatgacttctggaaatgttctagtaaaggatgctatttgg
gaacataaccgtcctttaatctctaaattgatggagatgggtgttgaagtgtcagaggaa
gaagatggtattcgtgtaaaagctgatactaaaaaattgaagccagtgactgtgaaaaca
ctccctcatccaggatttcctactgatatgcaagctcaatttacagctctaatggcagta
gttaatggcgaatcaactatgattgagacagtttttgaaaatcgttttcaacatttggaa
gaaatgcgtcgcatgggattacaaacggaaattttacgagatactgcaatgattcatggt
gggagagctttacaaggtgcaccggtcatgtctactgacttacgagctagtgcagcttta
atcttggcaggaatggttgcgcaagggcaaacagtagttggccaattaacccatttagac
cgtggttattatcaattccatgaaaaattagcggctcttggtgctaatattaaacgtgta
agtgaggcgtaa

DBGET integrated database retrieval system