KEGG   Simiduia agarivorans: M5M_00600Help
Entry
M5M_00600         CDS       T02281                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
saga  Simiduia agarivorans
Pathway
saga00260  Glycine, serine and threonine metabolism
saga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01130  Biosynthesis of antibiotics
saga01230  Biosynthesis of amino acids
Module
saga_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M5M_00600
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M5M_00600
Enzymes [BR:saga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M5M_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFU97355
UniProt: K4KGM8
Position
132751..134001
Genome map
AA seq 416 aa AA seqDB search
MELIVSKGEKQTVDFDAVPDAKGRFGEFGGRFVSETLIHALDELDAMYRQLKVDPDFQAE
FDRDLAHYVGRPSPLYFAEHLTRHVGGAQIYLKREDLNHTGAHKVNNTIGQALLAKHSGK
KRVIAETGAGQHGVATATVAARLGLKCQVYMGAEDVRRQALNVYRMKLLGAEVIAVKSGS
KTLKDAMNEAMRDWATNVDDTFYIIGTVAGPAPYPELVRDFQCVIGREARAQSLAQIGRL
PDALVACVGGGSNAIGLFHPFLKDQDVAIYGVEAGGDGVETGRHAAPLNDGIPGVLHGNR
TYLMEDENGQIIETHSVSAGLDYPGVGPEHAFLKDTGRANYVAINDAEALAAFRTLTRVE
GIMPALESSHAVAYAMKLAKQMDKDKVIVVNLSGRGDKDILTVADIDGIEVEGINR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggagttaatcgtgtcaaagggtgaaaagcaaaccgtggattttgacgcagtacctgat
gccaaaggccggttcggcgaatttggtggccggttcgtgtccgaaaccctgattcatgca
ttggatgagctggatgccatgtatcgccagctcaaggttgacccggattttcaggcagaa
tttgaccgggatctggcgcactatgtggggcgtccttcgccgctgtattttgcggagcac
ctcacccgccacgtgggcggcgcacaaatttacctgaagcgcgaagacctcaatcacacc
ggtgcgcacaaggtgaacaacaccatcggtcaggccctgctggccaagcactccggcaaa
aaacgcgttattgccgagaccggcgccggtcagcacggcgtggccacggccacggtagcg
gcccggctggggctgaaatgccaggtctacatgggtgccgaagacgtgcgccgacaggcg
ttgaatgtgtaccggatgaagctgttgggcgcggaagtgatcgcggtgaagtccggctcc
aaaacgctcaaggatgccatgaacgaagccatgcgcgattgggcgactaacgtggacgat
accttttacatcatcggtactgttgcgggcccggcgccgtaccctgaactggtgcgggac
ttccagtgcgttatcggtcgcgaagcgcgcgcccagtcactggcgcaaatcgggcgcctg
cctgatgcgctggtggcgtgtgtgggcggtggctccaacgccattggcctgttccatccg
ttcctgaaagatcaggatgttgcgatctacggcgtagaagcgggtggtgatggcgttgaa
accgggcgccatgcggcgccgctgaacgacggtatcccgggcgttctgcacggcaaccgc
acttacctgatggaagatgagaacggccagattatcgagacccacagcgtatctgccggg
ctcgactatcccggtgtgggtccagagcatgcattcctgaaagacaccggccgtgcgaac
tatgtggcgatcaacgacgccgaggcattggccgcgttccgcaccctgacccgggtagag
ggaattatgcccgcactggagtccagtcatgcggtggcttatgccatgaaactcgccaaa
caaatggacaaggacaaagtcatcgtggtgaacctgtccggccgtggcgacaaagatatc
ctcaccgttgccgacattgacggcatcgaagtggaaggcattaaccgatag

DBGET integrated database retrieval system