KEGG   Simiduia agarivorans: M5M_04445
Entry
M5M_04445         CDS       T02281                                 

Definition
(GenBank) type VI secretion protein, EvpB/family
  KO
K11899  type VI secretion system protein ImpD
Organism
saga  Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:saga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saga02044]
    M5M_04445
Secretion system [BR:saga02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   M5M_04445
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFU98096
UniProt: K4KGI1
Position
980964..982475
AA seq 503 aa
MSALTDAIDASKGQLARRDDIRIGLHPDQLSRFLATENSRDAFTHWLAVCPPGYRGARLR
NYLNAQIAQIDELICEQLNAIIHHGRFQALEARWLGLWQQVDASGIAENIKIKLLDVSWR
ELVRDIERAPDIDQSALFHLVYNLEFGTPGGEPFGVLLGDYEVSHKPDADHPHDDIATLQ
GISRTAAAAFAPFICGASPRLFGLDSFQALGQAINISSVFEHKEYTRWHAMRSQDDTRFI
ALALPKVLMRRPYNRKFQSFRGIRFQEYHQAHSTDYLWGNACFAIGTVLIREFAEVGWFS
HIRGVARDYHGGGLVSRFPCETFATDTHPARVRMNTQVLITDFQERELTEHGLISLCHCY
DTPYSAFNAMPSLQAPKRFNHKSADANARISAMLQQVMCASRFAQYIKVMIRDKVGAYIR
ADECERLLQQWLDRYTTGRDDLSWEMLARYPLREARVEVHEEPGNPGIYQSVIHLKTHYN
VDQLVSELRLTTSLSAGSVGTVK
NT seq 1512 nt   +upstreamnt  +downstreamnt
ttgtctgcacttaccgacgccatagacgccagcaaaggccagcttgcccgtagggacgac
attcgcatcggccttcaccctgaccagctgagcaggtttctggcaacggaaaacagtcgt
gacgcattcacccattggcttgcagtctgccctcccggttaccgtggcgcacgtctacgg
aactacctcaatgcacaaattgcccagatagacgaattgatttgcgagcaactgaacgcg
atcatccatcatggacgctttcaggcactggaggcacgttggcttggcctttggcagcaa
gtagatgccagtgggatagccgagaacatcaaaatcaagctactggacgtgagttggcga
gaattggtcagggatatagagcgcgcccctgacattgatcagtcagcactttttcatctg
gtgtacaacctcgaatttggcaccccgggtggagagccatttggcgtgttactgggtgac
tacgaggttagccataaaccagatgcagaccaccctcacgacgacattgcgacactgcag
ggcattagtcgcacagcggctgccgcgttcgcgccatttatatgcggagcgtcacccagg
ctattcggacttgatagctttcaggctctgggccaggcaatcaacatcagctcagtattt
gaacacaaagaatacacccggtggcacgccatgcgtagtcaggatgacacccgattcatc
gcgcttgccttacccaaggtattgatgcgaaggccatacaacagaaagttccagtctttt
cgcggcatccggtttcaggagtatcatcaggcccatagcaccgactacctttggggcaac
gcctgctttgctatcggaaccgtactgattcgggaatttgcggaagtgggttggttctcg
cacatccgtggagtcgccagagattatcacggtggcggactggtgagtcgttttccgtgc
gagacctttgccacggatacacatccggcaagagtccgtatgaatacgcaggtgctgata
acggattttcaggaacgagagctcacagaacacgggttaatcagcctatgccactgttac
gacacaccctattcggctttcaatgccatgccttcacttcaggcaccaaaacgatttaac
cacaaatcggcggacgccaatgccagaataagcgcgatgttacagcaagtaatgtgtgca
tcacgttttgcccaatacataaaggtaatgatccgtgacaaggtgggcgcctacattaga
gcagacgagtgcgaacgcctgttacagcagtggctggatcgctataccaccgggcgtgat
gatctgtcgtgggaaatgcttgcgcgttatccattgcgggaggcgagagtcgaagtacac
gaagaacccggcaatccgggcatttaccaaagcgtcattcacctaaaaacccactacaac
gtcgaccaactggtttccgaattaagactgactacatctttgtcagcgggatctgtaggt
acagtaaagtaa

DBGET integrated database retrieval system