KEGG   Simiduia agarivorans: M5M_07165Help
Entry
M5M_07165         CDS       T02281                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
saga  Simiduia agarivorans
Pathway
saga00010  Glycolysis / Gluconeogenesis
saga00030  Pentose phosphate pathway
saga00051  Fructose and mannose metabolism
saga00052  Galactose metabolism
saga00680  Methane metabolism
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_07165
   00030 Pentose phosphate pathway
    M5M_07165
   00051 Fructose and mannose metabolism
    M5M_07165
   00052 Galactose metabolism
    M5M_07165
  Energy metabolism
   00680 Methane metabolism
    M5M_07165
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     M5M_07165
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     M5M_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFU98628
UniProt: K4KKQ9
Position
1609387..1610643
Genome map
AA seq 418 aa AA seqDB search
MTRKNAFYAQSGGVTAVINASACGVIETARAHSDKIGTVYAGNNGIIGALREELIDTSAE
SADTIAALRHTPSGAFGSCRYKLKSLEQNRAEYERLIDVFKAHDIGYFFYNGGGDSADTC
LKISQLSETMGYPIQAIHIPKTVDNDLPFTDNCPGFGSVAKYVAVSIREAGLDVASMCES
STKVFIMEVMGRHAGWIAAAGGLAAEVDGDAPQIILFPEIAFDKAKFLARVDECVKRYGY
CAIVASEGAQYADGSFLADSGNVDAFGHKQLGGVAPTLASMVKQELGYKYHWALADYLQR
AARHIASGTDVEQAYAVGKAAVEKAIEGKSGIMPTIERAASAEYRWSIGEAPLDQVANVE
RKMPRDYISEDGFHITDKARDYLLPLIQGEDYPPYRDGMPVYAKLKKVMTPKKLADWQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggaaaaacgcgttttacgcgcaatccggtggggtaactgcggtgatcaatgcc
agcgcctgcggcgtgattgagactgcccgggcccacagcgacaagatcggcacagtgtac
gccggcaataacggcatcatcggtgcgctgcgcgaagagctgatcgataccagcgccgag
tcagccgacaccattgccgccctgcgccatacgccttcaggcgccttcggctcctgtcgc
tacaaactgaaaagcctggaacaaaaccgggccgagtacgagcgcctcattgatgtgttc
aaagcgcacgacatcggttattttttttacaacggcggtggtgactcggccgacacctgc
ctgaaaatcagccagctgtctgaaaccatgggttatcccattcaggcgatccatattccc
aaaaccgtggataacgacctgccgtttaccgacaactgcccgggattcggctctgtggcg
aaatacgtggctgtgtccatccgcgaagcgggcctggacgttgcttccatgtgcgaatcc
tccaccaaggtgttcatcatggaggtcatgggccgccacgcgggctggattgcggctgcc
ggcggactcgctgccgaagtggacggcgatgcgcctcagattatcctgttcccggaaatc
gccttcgataaggccaaattcctcgcgcgcgtggacgaatgcgttaagcgctacggttac
tgcgccatcgtcgcctctgaaggtgcccagtatgcagacggcagcttcctggccgactcc
ggtaacgtcgacgcctttggccacaaacaactgggtggcgtagcgccaacactggccagc
atggtcaagcaggaactgggctacaaataccactgggcactggccgattatctgcaacgc
gccgcgcgtcacattgcctccggcaccgacgttgaacaagcctatgcagtgggcaaagcc
gccgtggaaaaagccatcgaaggcaaaagtggcatcatgcccaccatcgagcgcgcagcc
tctgctgaataccgctggtccattggcgaagcaccgctggatcaggtagcgaatgtggag
cgcaagatgccgcgcgactacatcagtgaagacggcttccacatcaccgacaaagcccgt
gactatctgctgccgttaatccagggcgaagactacccgccctaccgcgacggcatgccg
gtatatgccaagctgaaaaaagtcatgacgcccaaaaaactggccgactggcagtaa

DBGET integrated database retrieval system