KEGG   Simiduia agarivorans: M5M_07365Help
Entry
M5M_07365         CDS       T02281                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
saga  Simiduia agarivorans
Pathway
saga00010  Glycolysis / Gluconeogenesis
saga00051  Fructose and mannose metabolism
saga00562  Inositol phosphate metabolism
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
saga01200  Carbon metabolism
saga01230  Biosynthesis of amino acids
Module
saga_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_07365 (tpiA)
   00051 Fructose and mannose metabolism
    M5M_07365 (tpiA)
   00562 Inositol phosphate metabolism
    M5M_07365 (tpiA)
Enzymes [BR:saga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M5M_07365 (tpiA)
Exosome [BR:saga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M5M_07365 (tpiA)
  Exosomal proteins of bladder cancer cells
   M5M_07365 (tpiA)
  Exosomal proteins of melanoma cells
   M5M_07365 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM SAT
Motif
Other DBs
NCBI-ProteinID: AFU98668
UniProt: K4KKW1
Position
complement(1650769..1651506)
Genome map
AA seq 245 aa AA seqDB search
MRRSLVMGNWKMNGSLAANQVLLEALLAKWQGVHKAEVAVAPVSLHLAQVGQLLSGSNIQ
LAAQDASAHASGAFTGEVAAAMLSELDCRYVIVGHSERRQYHAESSELVAKKAKAVLAEG
MVPVVCVGETLSERDAGQTLAVISEQLSPVIALFGASLAQIVVAYEPVWAIGTGKTATPE
QAQAVHAFIRDQLGAAGEQVRILYGGSVKPANAEALFAKTDIDGALVGGAALKADDFYAI
CRAAD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgttccctggtgatgggcaactggaagatgaacggcagtctggctgccaatcag
gtgctgcttgaggcgctcctggctaaatggcagggtgtgcacaaagctgaagtcgcggtc
gcgcctgtgtcgttgcacttggcacaagtcggtcagctgctgagcggcagtaatatccag
ttagccgcgcaagatgccagcgcacatgcgagtggggcgtttaccggtgaggttgcggcc
gccatgttgtcggaactcgattgtcgctatgtgatcgtcggccactccgagcgcaggcaa
tatcatgcagagtccagtgagctggtcgccaaaaaggcgaaagcggtgcttgctgaaggc
atggtgccggtggtttgtgtaggcgagacgctgtctgagcgcgacgccggccagactctc
gcagtcatcagcgagcagctgtcaccggtgattgcattgtttggtgcgtcgctggcgcaa
attgttgtggcgtatgagcccgtatgggcaattggcacaggtaaaacggcgacgcccgag
caggcccaggcagtgcacgcgttcattcgcgaccaattgggcgctgcaggcgagcaggtc
agaattttatacggcggcagtgtcaagccggccaatgccgaggcgctgtttgccaagacg
gatatagacggtgcgctggttggtggcgcagcgctcaaagcagatgacttttacgccatt
tgccgggcggccgattga

DBGET integrated database retrieval system