KEGG   Simiduia agarivorans: M5M_08505Help
Entry
M5M_08505         CDS       T02281                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saga  Simiduia agarivorans
Pathway
saga00071  Fatty acid degradation
saga00072  Synthesis and degradation of ketone bodies
saga00280  Valine, leucine and isoleucine degradation
saga00310  Lysine degradation
saga00362  Benzoate degradation
saga00380  Tryptophan metabolism
saga00620  Pyruvate metabolism
saga00630  Glyoxylate and dicarboxylate metabolism
saga00640  Propanoate metabolism
saga00650  Butanoate metabolism
saga00900  Terpenoid backbone biosynthesis
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
saga01200  Carbon metabolism
saga01212  Fatty acid metabolism
saga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M5M_08505
   00630 Glyoxylate and dicarboxylate metabolism
    M5M_08505
   00640 Propanoate metabolism
    M5M_08505
   00650 Butanoate metabolism
    M5M_08505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M5M_08505
   00072 Synthesis and degradation of ketone bodies
    M5M_08505
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M5M_08505
   00310 Lysine degradation
    M5M_08505
   00380 Tryptophan metabolism
    M5M_08505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M5M_08505
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M5M_08505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M5M_08505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saga04147]
    M5M_08505
Enzymes [BR:saga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M5M_08505
Exosome [BR:saga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M5M_08505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFU98890
UniProt: K4KKX6
Position
complement(1885637..1886845)
Genome map
AA seq 402 aa AA seqDB search
MPHHAYIYDAVRTPRSKGKKDGSLHEVKPIDLGAGLLQALAERHSLDTAYVDDVVMGCVT
PVGEQGSDVAKMIVQNAGWDESVPGVQLDRFCASGLEAVNIAAQKIASGWEDLVVAGGVE
SMSRVPMGSNGGAMGGDAAFSLKTGFVPQGIGADTIATLEGWSREDVDRYALESQKRAAH
AQANGYFDRSVIPVRDANGLMILERDEFIKPDTTLEILGKLKASFEMMGGLGFDDIILRK
YNHLTRVNHVHTPGNSSGIVDGAAAVLIGSEKAGKDLGLTPRARIVATAVLATDPIIMLT
GPGPAAEKALRKAGLSHGDIDLWEINEAFASVALRYMKDLNLDHEITNVNGGAIAMGHPL
GATGAMLISTMVDELERRQAKRAMISLCVGGGMGISTIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccacgcttatatctacgacgctgttcgcacgccacgctccaaaggtaaaaaa
gacggcagcctgcacgaagtcaaacctatcgatctgggcgccggcctgttacaggcgctg
gcggagcgtcacagtctggacaccgcctatgtggacgatgtggtcatgggctgcgtcacc
ccggtgggcgagcagggttcggatgtggcgaaaatgatcgtccagaacgccggctgggat
gaatcggtgccgggcgtgcagctggatcggttctgcgcctcgggcctggaggcggtgaat
attgccgcgcaaaagattgcgtccggttgggaggatttggtggtggccggcggggtggaa
tccatgtcgcgggtacccatgggctccaatggcggtgccatgggtggtgatgccgccttc
agtctgaaaactggttttgtgccgcagggcatcggtgctgacaccatcgccacgctggaa
ggctggagccgcgaggatgtggatcgctacgcgctggaaagccagaagcgggcagcccat
gcgcaagccaatggctatttcgatcgctcggtgattcccgtgcgcgatgccaacggcctg
atgattctggaacgcgatgaattcatcaagcccgataccactctcgagattcttggcaaa
ctcaaagcttcgttcgaaatgatgggcggcctgggtttcgacgatattatcctgcgcaag
tacaaccatctcacccgcgtgaatcacgtgcacacgccaggcaattcctccggcatagtg
gatggtgcggccgccgtcctcattggcagtgaaaaggccggcaaggatctcgggctcaca
ccgcgcgcgcgcattgtcgccaccgctgtgctcgcaaccgatccgatcattatgctcaca
ggcccgggccctgcggcggaaaaggctctgcgaaaagcgggtctcagccacggcgatatt
gacctatgggaaatcaacgaagcctttgcctcggtggcactgcgctacatgaaagacctt
aatctcgatcatgaaatcactaacgtcaacggcggtgccattgccatgggccatccctta
ggcgccaccggcgccatgctgatcagcaccatggtggatgagctggagcgacgccaggcc
aaacgcgcgatgatttcattgtgtgtgggtggcggtatgggtatttccaccattatcgag
cgggtgtaa

DBGET integrated database retrieval system