KEGG   Simiduia agarivorans: M5M_13620Help
Entry
M5M_13620         CDS       T02281                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
saga  Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:saga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    M5M_13620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: AFU99864
UniProt: K4KL30
Position
complement(2977565..2978833)
Genome map
AA seq 422 aa AA seqDB search
MSVIAEYGQIFLVLACIFGLFMAWGVGANDVANAMGTSVGSKALTIKQAIIIAMVFEFLG
AYLAGGAVTDTIRKGIIDPGMLADTPELLVYGMMAALLAAGTWLLAASILGWPVSTTHSI
VGAIVGFAVAGIGMNAVNWGKVGTIAASWVVSPLLAGTIAFMLFRSVQRLILDTDNPLAN
AKKYVPVYMFFVGFLISMVTLLKGLKHVFKDSGFKLSFLESMGLSALIGLLVAGFGIYLL
RQLKPVSEKESRFANVEQVFAILMIFTACSMAFAHGSNDVANAVGPMAAIVATVKTGAIG
AKAAMPGWILLVGAIGIVIGLATYGHRVMATIGKKITHLTPSRGFAAELGAAGTVVLASG
TGLPISTTHTLVGAVLGVGLARGIGALNLRVIGSIFMSWIVTLPAGALLAVVFFYFFKGL
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttattgctgaatacggccagatttttctggtcctggcctgtattttcggtctg
tttatggcctggggtgtgggtgcgaatgacgtcgccaacgccatgggcacctcggtgggc
tccaaggccctcaccatcaaacaggcgattattatcgccatggtgttcgaattcctgggc
gcctatctggcgggcggtgcggtcaccgataccatccgcaagggcattatcgaccctggc
atgctcgccgacacaccagaattactggtgtacggcatgatggccgccttgctggccgcg
ggcacctggctgctggcggcgtctatcctcggctggccggtgtccaccacccactccatc
gtgggtgccattgtaggctttgccgtcgccggcatcggcatgaacgcggtgaactggggc
aaggttggcactatcgccgccagctgggtggtttcgccgctactggcgggcaccattgcc
ttcatgctgttccgcagcgtgcaacggctgattctcgacaccgacaaccccctggccaac
gccaaaaagtacgtgccggtgtacatgttcttcgtgggctttctgatcagcatggtgacc
ttgctgaagggcctgaagcacgtattcaaggacagcggtttcaagctcagcttcctggag
tccatgggcctgtccgccttgatcgggctcttggtggccggtttcggtatttacctgctg
cgccagctcaaacccgtcagtgaaaaagaatcccgctttgccaacgttgagcaggtattt
gccatcctgatgatttttaccgcctgttccatggcgttcgcccacggttccaacgatgtg
gccaacgccgtcggccccatggcagccattgtcgccacggtgaaaaccggggccattggt
gccaaagccgctatgcccggctggatcctgctggtgggcgcaatcggtatcgtgattggt
ctcgccacctacggccaccgggtcatggccaccatcggcaagaaaatcacccacctgacc
ccgagccgcggctttgccgccgagctgggtgccgctggcacggtggtactcgcgtccggt
accgggctgcccatttctaccacccacacactggtgggcgcggtactgggtgtaggcctg
gcgcgcggtattggtgcgctcaacctgcgcgtgatcggcagtatcttcatgtcgtggatc
gtcaccctgccggcgggcgccttgctggcggtagtgttcttttacttcttcaaggggctg
ttcagctaa

DBGET integrated database retrieval system