KEGG   Streptococcus agalactiae 138spar: DN94_02625Help
Entry
DN94_02625        CDS       T03383                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagc  Streptococcus agalactiae 138spar
Pathway
sagc00071  Fatty acid degradation
sagc00072  Synthesis and degradation of ketone bodies
sagc00280  Valine, leucine and isoleucine degradation
sagc00310  Lysine degradation
sagc00362  Benzoate degradation
sagc00620  Pyruvate metabolism
sagc00630  Glyoxylate and dicarboxylate metabolism
sagc00640  Propanoate metabolism
sagc00650  Butanoate metabolism
sagc00900  Terpenoid backbone biosynthesis
sagc01100  Metabolic pathways
sagc01110  Biosynthesis of secondary metabolites
sagc01120  Microbial metabolism in diverse environments
sagc01130  Biosynthesis of antibiotics
sagc01200  Carbon metabolism
sagc01212  Fatty acid metabolism
sagc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DN94_02625
   00630 Glyoxylate and dicarboxylate metabolism
    DN94_02625
   00640 Propanoate metabolism
    DN94_02625
   00650 Butanoate metabolism
    DN94_02625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DN94_02625
   00072 Synthesis and degradation of ketone bodies
    DN94_02625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DN94_02625
   00310 Lysine degradation
    DN94_02625
   00380 Tryptophan metabolism
    DN94_02625
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DN94_02625
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DN94_02625
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DN94_02625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagc04147]
    DN94_02625
Enzymes [BR:sagc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DN94_02625
Exosome [BR:sagc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DN94_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHX74623
Position
467690..468805
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETPTKISDYDAIEWNGPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaatcagaatctaatattgatagtattatttgtgggaacacggttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaacg
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaaggttgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcctactaaa
atatcggattatgatgcaattgaatggaatggaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system