KEGG   Streptococcus agalactiae NGBS061: EN72_02720Help
Entry
EN72_02720        CDS       T03516                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sage  Streptococcus agalactiae NGBS061
Pathway
sage00071  Fatty acid degradation
sage00072  Synthesis and degradation of ketone bodies
sage00280  Valine, leucine and isoleucine degradation
sage00310  Lysine degradation
sage00362  Benzoate degradation
sage00380  Tryptophan metabolism
sage00620  Pyruvate metabolism
sage00630  Glyoxylate and dicarboxylate metabolism
sage00640  Propanoate metabolism
sage00650  Butanoate metabolism
sage00900  Terpenoid backbone biosynthesis
sage01100  Metabolic pathways
sage01110  Biosynthesis of secondary metabolites
sage01120  Microbial metabolism in diverse environments
sage01130  Biosynthesis of antibiotics
sage01200  Carbon metabolism
sage01212  Fatty acid metabolism
sage02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sage00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EN72_02720
   00630 Glyoxylate and dicarboxylate metabolism
    EN72_02720
   00640 Propanoate metabolism
    EN72_02720
   00650 Butanoate metabolism
    EN72_02720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EN72_02720
   00072 Synthesis and degradation of ketone bodies
    EN72_02720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EN72_02720
   00310 Lysine degradation
    EN72_02720
   00380 Tryptophan metabolism
    EN72_02720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EN72_02720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EN72_02720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EN72_02720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sage04147]
    EN72_02720
Enzymes [BR:sage01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EN72_02720
Exosome [BR:sage04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EN72_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AIF86018
UniProt: A0A0E1EFN2
Position
476308..477423
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGTLAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttatgctaaagaagataatcgtaacggagaatatacagttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctctattt
aatcattattatcctgaagagagagaaaaattcaatatttttggagggacattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system