KEGG   Streptococcus agalactiae NGBS061: EN72_09530Help
Entry
EN72_09530        CDS       T03516                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sage  Streptococcus agalactiae NGBS061
Pathway
sage00260  Glycine, serine and threonine metabolism
sage01100  Metabolic pathways
sage01110  Biosynthesis of secondary metabolites
sage01120  Microbial metabolism in diverse environments
sage01130  Biosynthesis of antibiotics
sage01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sage00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EN72_09530
Enzymes [BR:sage01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EN72_09530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIF87310
UniProt: A0A0E1EJA8
Position
complement(1842803..1843828)
Genome map
AA seq 341 aa AA seqDB search
MLHFENDYNKGAHPELLNALIETNDQGLSGYRTDSYCQQAADKIREVCSCPQAEVEFLVG
GTQTNQVVISSMLASYEGVIAAETGHVSSHEAGAIEFSGHKVLTLPSHNGKLLASEVATY
IETFYADGNYQHMVFPGMVYISHPTEYGTLYSKAELEELSKICKHYQIPLFIDGARLGYG
LAAKDTDVDFPTIAALSDVFYIGGTKMGALAGEAVVFTKKNRPKQFTTIVKQHGALLAKG
RLLGLAFDRFFTDDLYLKIGKHAIDLAEELKIILEEKGYSFYLKSPTNQQFIIVENTKLA
DLAKNVAYSFWEKYDDHHTVIRLATSWSTSREDVTALRNVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgattataataaaggagctcatccagagcttttgaatgccctt
attgaaactaatgatcaaggtctatcgggatataggacagatagttactgtcaacaagcg
gcagataaaattcgagaagtctgttcctgtccacaagctgaagttgagtttttagtgggt
ggtactcaaacaaatcaagtagttatcagtagtatgcttgcttcttatgaaggagttatt
gctgcagaaacaggtcatgtgagtagtcatgaagcaggagccatagaattttcaggtcat
aaggtattgactttaccttctcataatgggaaattactcgcaagcgaagttgcaacttat
attgagactttttatgctgatggtaattaccaacacatggtttttccaggaatggtttat
atatcacatccaacagaatatggaacactttatagtaaagcagaactagaagagttgtcg
aagatttgtaaacattatcaaatccccttatttattgacggtgctcgtctggggtatggt
ttggctgcgaaagatacagatgttgatttcccaacgattgcagccttatcagatgttttt
tatattggcggaactaaaatgggggctcttgctggggaagcagttgttttcacaaagaaa
aatcgtccaaaacagtttactacaattgtaaagcagcatggtgcgttattagccaaggga
agattgctgggacttgcttttgatcgtttctttacggatgacctttacttaaaaattgga
aagcatgcgatcgacttagcagaggaattaaaaatcattttagaagaaaaaggttactca
ttctatttaaaatcaccaactaatcaacaatttattattgtagaaaatacaaaactagca
gatttagcaaagaatgtagcttatagtttttgggaaaaatatgatgaccatcatactgta
atacgtctagcaactagttggtcaactagtcgcgaagatgtaactgctttaagaaatgtc
ttgtga

DBGET integrated database retrieval system