KEGG   Streptococcus agalactiae NGBS572: EN73_01935Help
Entry
EN73_01935        CDS       T03517                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sagg  Streptococcus agalactiae NGBS572
Pathway
sagg00561  Glycerolipid metabolism
sagg00640  Propanoate metabolism
sagg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EN73_01935
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    EN73_01935
Enzymes [BR:sagg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     EN73_01935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase CagD
Motif
Other DBs
NCBI-ProteinID: AIF87987
Position
341464..342552
Genome map
AA seq 362 aa AA seqDB search
MKVFASPSRYIQGKDALFQSIEHIKSLGQTPLILCDDVVYNIVGESFLSYLQDDLLPHRV
SFNGEASDNEINRVVAVAKEKNSDLIIGLGGGKTIDSAKAIADKVNLPVVIAPTVASTDA
PTSALSVIYTDEGAFEKYIFYSKNPDLVLVDTQVIAQAPKRLLASGIADGLATWVEARAV
LQKNGIAMAGGRQTLAGVAIAQACERTLFNDSLQALAACDAKVVTKALENVIEANTLLSG
LGFESAGLAAAHAIHNGFTALSGDIHHLTHGEKVAYGTLTQLFLENRPKEEIDRYINLYQ
AIGMPTTLAELHLGDATYEELLKVGQQATIEGETIHEMPFKISAEDVAAALLAVDRYVSN
HQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttcgcaagtccatcgcgctatatacaaggaaaggatgctttattccaaagt
attgaacatatcaaatctttaggtcagactccacttatcctttgtgatgatgttgtttat
aatatcgttggagaaagttttttatcttatctacaagacgatttgttaccacatcgtgtc
tcctttaacggagaagcatctgataatgaaatcaatcgtgtcgttgctgttgcgaaagaa
aagaatagtgaccttattattggacttggtggtggaaaaactattgactctgcaaaggca
attgcagataaagttaatttaccagtggtcattgcaccaacagtagcttcaacagatgcc
ccaacatcagcgttatcagtaatctatacagatgaaggagcttttgaaaaatatattttt
tattcaaagaatccagacttagttttggtcgatactcaagtaattgctcaagcgccaaaa
cgtttactagcttctgggattgcagatggcttagctacttgggttgaagcgagagcagtc
ttacaaaaaaatggaatagcgatggctggcggtagacagactttagcgggcgtggcaatt
gcccaagcatgtgagcgtactttatttaatgatagtttacaagctttagcggcttgtgat
gccaaagtggttacaaaagctttagaaaatgttattgaagctaataccttacttagtggt
ttaggttttgaaagtgcaggattagctgcagctcatgctattcataatggttttactgcc
ttgagtggagatattcatcacttaacccatggtgaaaaagttgcctatggaacgttgacg
caacttttcctcgaaaatagaccaaaggaagaaattgatcgctacattaatctttaccaa
gcgattggaatgccaactacacttgcagaactccatttgggtgatgcaacatatgaagaa
cttttaaaagttggtcagcaagcaacaattgaaggtgaaacaatacatgaaatgccattc
aaaattagtgcagaggatgtcgctgcagccctgttagcagttgaccgctatgtttcaaat
catcaataa

DBGET integrated database retrieval system