KEGG   Streptococcus agalactiae NGBS572: EN73_02795Help
Entry
EN73_02795        CDS       T03517                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagg  Streptococcus agalactiae NGBS572
Pathway
sagg00071  Fatty acid degradation
sagg00072  Synthesis and degradation of ketone bodies
sagg00280  Valine, leucine and isoleucine degradation
sagg00310  Lysine degradation
sagg00362  Benzoate degradation
sagg00380  Tryptophan metabolism
sagg00620  Pyruvate metabolism
sagg00630  Glyoxylate and dicarboxylate metabolism
sagg00640  Propanoate metabolism
sagg00650  Butanoate metabolism
sagg00900  Terpenoid backbone biosynthesis
sagg01100  Metabolic pathways
sagg01110  Biosynthesis of secondary metabolites
sagg01120  Microbial metabolism in diverse environments
sagg01130  Biosynthesis of antibiotics
sagg01200  Carbon metabolism
sagg01212  Fatty acid metabolism
sagg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EN73_02795
   00630 Glyoxylate and dicarboxylate metabolism
    EN73_02795
   00640 Propanoate metabolism
    EN73_02795
   00650 Butanoate metabolism
    EN73_02795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EN73_02795
   00072 Synthesis and degradation of ketone bodies
    EN73_02795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EN73_02795
   00310 Lysine degradation
    EN73_02795
   00380 Tryptophan metabolism
    EN73_02795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EN73_02795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EN73_02795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EN73_02795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagg04147]
    EN73_02795
Enzymes [BR:sagg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EN73_02795
Exosome [BR:sagg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EN73_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AIF88133
Position
505059..506174
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIEPESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISADINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREILDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaaccagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgctgatattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttacgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatattagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system