KEGG   Streptococcus agalactiae ILRI005: MSA_2740Help
Entry
MSA_2740          CDS       T02704                                 

Definition
(GenBank) Cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MSA_2740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sagi01007]
    MSA_2740
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sagi03016]
    MSA_2740
Enzymes [BR:sagi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     MSA_2740
Amino acid related enzymes [BR:sagi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MSA_2740
Transfer RNA biogenesis [BR:sagi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MSA_2740
 Prokaryotic Type
    MSA_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 RAG1 Phage_min_cap2 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: CCW39167
Position
226584..227927
Genome map
AA seq 447 aa AA seqDB search
MIKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYCGYQ
VNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALGVKPATKNPRVIDYMDE
IIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLEIGASGRVDGEGEIKENP
LDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNE
IAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHDMLKSVDGQVIRFFLATQQY
RKPVNFTEKAVHDAEVNLKYLKNTFNLPIQENANDEELEQFVKAFQEAMDDDFNTANGIT
VIFEMAKWINSGHYTSKVKETFAELLEILGIVFQEEVLDADIETLIEQRQEARANRDFAT
ADRIRDELAKQGIKLLDTKDGVRWTRD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatttacgacactatgactcgcagtttacaagattttatacctctcaatgaa
ggtaaagtcaacatgtacgtctgtgggccaacagtttataactatatacacatcgggaat
gcccgcagtgtagtagcttttgatactattcgtcgttattttgagtattgtgggtaccaa
gtcaattatatttctaactttactgatgttgatgataaaattataaaaggtgcagctgaa
gcaggtatggatacaaaatccttttcagataagtttatttcagcatttatggaagatgtt
gctgcattaggtgtcaaacctgctacaaaaaatcctcgagttattgactatatggatgag
attattgattttgttaaagttttagttgataaggaatttgcctatgaagctaatggagat
gtttattttagagtaagtaaatcacatcattatgcaaaattagccaataaaactttggaa
gatttagagattggtgcaagtggtcgtgttgatggtgaaggagagattaaagagaatcct
ttagattttgcactttggaaatcagctaaatctggggaagtctcatgggaaagtccttgg
gggaaagggcgcccagggtggcatattgaatgttctgttatggcaactgagatccttggt
gatactattgatatccatggtggaggagctgatttagaatttccacatcacacgaatgag
attgcacaatctgaagctaaaacaggtaagacctttgcaaattactggatgcataatggt
tttgttaacgttgataacgagaaaatgtctaaatctcttggtaactttattactgttcac
gatatgttgaagagcgttgacggacaagtaatacgttttttcttagcgacacaacagtat
cgtaaacccgtgaatttcactgaaaaggccgttcatgatgcggaagttaaccttaaatat
ttaaaaaatactttcaacttaccaatccaagagaatgctaatgatgaagaattagagcaa
tttgtgaaagcatttcaagaagcgatggatgatgattttaatacagcaaacggtattact
gttatctttgaaatggcaaaatggattaattcaggacactatacttcaaaagttaaggaa
acctttgctgaattattagaaattttgggtattgtattccaagaggaagttcttgatgct
gatattgaaactttaatagaacaacgtcaagaagcacgagctaatcgtgattttgcaact
gctgatcgtattagagatgaattagcaaaacaaggaattaaattgttagatactaaggat
ggcgtgaggtggactcgtgattga

DBGET integrated database retrieval system