KEGG   Streptococcus agalactiae ILRI005: MSA_5710Help
Entry
MSA_5710          CDS       T02704                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00071  Fatty acid degradation
sagi00072  Synthesis and degradation of ketone bodies
sagi00280  Valine, leucine and isoleucine degradation
sagi00310  Lysine degradation
sagi00362  Benzoate degradation
sagi00380  Tryptophan metabolism
sagi00620  Pyruvate metabolism
sagi00630  Glyoxylate and dicarboxylate metabolism
sagi00640  Propanoate metabolism
sagi00650  Butanoate metabolism
sagi00900  Terpenoid backbone biosynthesis
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01130  Biosynthesis of antibiotics
sagi01200  Carbon metabolism
sagi01212  Fatty acid metabolism
sagi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSA_5710
   00630 Glyoxylate and dicarboxylate metabolism
    MSA_5710
   00640 Propanoate metabolism
    MSA_5710
   00650 Butanoate metabolism
    MSA_5710
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSA_5710
   00072 Synthesis and degradation of ketone bodies
    MSA_5710
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSA_5710
   00310 Lysine degradation
    MSA_5710
   00380 Tryptophan metabolism
    MSA_5710
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSA_5710
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSA_5710
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MSA_5710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagi04147]
    MSA_5710
Enzymes [BR:sagi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MSA_5710
Exosome [BR:sagi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSA_5710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CCW39433
Position
493719..494834
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKEAFFQKLPRLMENSPFLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaatcagaatctaatattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcacaaagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaagcattttttcaaaaattaccaagattgatggaaaattca
ccttttctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagagactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system