KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0444Help
Entry
GBS222_0444       CDS       T02656                                 

Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00071  Fatty acid degradation
sagl00072  Synthesis and degradation of ketone bodies
sagl00280  Valine, leucine and isoleucine degradation
sagl00310  Lysine degradation
sagl00362  Benzoate degradation
sagl00620  Pyruvate metabolism
sagl00630  Glyoxylate and dicarboxylate metabolism
sagl00640  Propanoate metabolism
sagl00650  Butanoate metabolism
sagl00900  Terpenoid backbone biosynthesis
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01130  Biosynthesis of antibiotics
sagl01200  Carbon metabolism
sagl01212  Fatty acid metabolism
sagl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0444
   00630 Glyoxylate and dicarboxylate metabolism
    GBS222_0444
   00640 Propanoate metabolism
    GBS222_0444
   00650 Butanoate metabolism
    GBS222_0444
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GBS222_0444
   00072 Synthesis and degradation of ketone bodies
    GBS222_0444
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBS222_0444
   00310 Lysine degradation
    GBS222_0444
   00380 Tryptophan metabolism
    GBS222_0444
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBS222_0444
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GBS222_0444
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GBS222_0444
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagl04147]
    GBS222_0444
Enzymes [BR:sagl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GBS222_0444
Exosome [BR:sagl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBS222_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CCO74244
Position
468150..469265
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETPTKISDYDAIEWNGPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaatcagaatctaatattgatagtattatttgtgggaacacggttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaacg
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaaggttgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcctactaaa
atatcggattatgatgcaattgaatggaatggaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system