KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1477Help
Entry
GBS222_1477       CDS       T02656                                 

Gene name
ltaE
Definition
(GenBank) putative low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00260  Glycine, serine and threonine metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01130  Biosynthesis of antibiotics
sagl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GBS222_1477 (ltaE)
Enzymes [BR:sagl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     GBS222_1477 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCO75147
Position
complement(1530463..1531488)
Genome map
AA seq 341 aa AA seqDB search
MLHFENDYNKGAHPELLNALIETNDQGLSGYGTDSYCQQAADKIREVCSCPQAEVEFLVG
GTQTNQVVISSMLASYEGVIAAETGHVSSHEAGAIEFSGHKVLTLPSHNGKLLASEVATY
IETFYADGNYQHMVFPGMVYISHPTEYGTLYSKAELEELSKICKHYQIPLFIDGARLGYG
LAAKDTDVDFPTIAALSDVFYIGGTKMGALAGEAVVFTKKNRPKQFTTIVKQHGALLAKG
RLLGLAFDRFFTDDLYLKIGKHAIDLAEELKIILEEKGYSFYLKSPTNQQFIIVENTKLA
DLAKNVAYSFWEKYDDHHTVIRLATSWSTSREDITALRNVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgattataataaaggagctcatccagagcttttgaatgccctt
attgaaactaatgatcaaggtctatcgggatatgggacagatagttactgtcaacaagcg
gcagataaaattcgagaagtctgttcctgtccacaagctgaagttgagtttttagtgggt
ggtactcaaacaaatcaagtagttatcagtagtatgcttgcttcttatgaaggagttatt
gctgcagaaacaggtcatgtgagtagtcatgaagcaggagccatagaattttcaggtcat
aaggtattgactttaccttctcataatgggaaattactcgcaagcgaagttgcaacttat
attgagactttttatgctgatggtaattaccaacacatggtttttccaggaatggtttat
atatcacatccaacagaatatggaacactttatagtaaagcagaactagaagagttatcg
aagatttgtaaacattatcaaatccccttatttattgacggtgctcgtctggggtatggt
ttggctgcgaaagatacagatgttgatttcccaacgattgcagccttatcagatgttttt
tatattggtggaaccaaaatgggggctcttgctggggaagcagttgttttcacaaagaaa
aatcgtccaaaacagtttactacaattgtaaagcagcatggtgcgttattagccaaggga
agattgctggggcttgcttttgatcgtttctttacggatgacctttacttaaagattgga
aagcatgcgattgacttagcagaggaattaaaaatcattttagaagaaaaaggttactcg
ttctatttaaaatcaccaactaatcaacaatttattattgtagaaaatacaaaactagca
gatttagcaaagaatgtagcttatagtttttgggaaaaatatgatgaccatcatactgta
atacgtctagcaactagttggtcaactagtcgcgaagatataactgctttaagaaatgtc
ttgtga

DBGET integrated database retrieval system