KEGG   Streptococcus agalactiae 09mas018883: BSA_17340Help
Entry
BSA_17340         CDS       T02703                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00220  Arginine biosynthesis
sagm00250  Alanine, aspartate and glutamate metabolism
sagm00290  Valine, leucine and isoleucine biosynthesis
sagm01100  Metabolic pathways
sagm01110  Biosynthesis of secondary metabolites
sagm01130  Biosynthesis of antibiotics
sagm01210  2-Oxocarboxylic acid metabolism
sagm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSA_17340
   00290 Valine, leucine and isoleucine biosynthesis
    BSA_17340
   00220 Arginine biosynthesis
    BSA_17340
Enzymes [BR:sagm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BSA_17340
    2.6.1.66  valine---pyruvate transaminase
     BSA_17340
Amino acid related enzymes [BR:sagm01007]
 Aminotransferase (transaminase)
  Class I
   BSA_17340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cor1
Motif
Other DBs
NCBI-ProteinID: CCW38501
Position
complement(1690706..1691917)
Genome map
AA seq 403 aa AA seqDB search
MKIFDKSMKLEHVAYDIRGPVLEEADRMRANGEKILRLNTGNPAAFGFEAPDEVIRDLIT
NARESEGYSDSKGIFSARKAVMQYYQLQNIHVDMDDIYIVNGVSEGISMSMQALLDNDDE
VLVPMPDYPLWTACVSLAGGNAVHYICDEEANWYPDIDDIKSKITSKTKAIVLINPNNPT
GAVYPREILQEIVDIARQNDLIIFSDEVYDRLVMDGMEHIPIASIAEDIFTVTLSGLSKS
HRICGFRVGWMVLSGPRQHVKGYIEGLNMLANMRLCSNVLAQQVIQTSLGGQQSIDSMLL
PGGRIYEQRNYIHKAINEIPGLSAVKPNAGLYLFPKIDTDMYRIDNDEEFVLNFLKQEKV
LLTHGRGFNMNTADHFRIVYLPRVDELTELQEKMARFLSRYKR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatttgataaatcaatgaagctggaacatgtggcttatgatattagaggccct
gttttagaagaggcggaccgcatgagggcaaatggtgaaaagatattgcggttaaatact
ggaaatccagctgcctttggcttcgaagcgccagatgaagtcattcgtgatttaattacg
aatgcgcgtgaatcagaaggttactctgattcgaaaggtattttttcagctcgtaaggct
gttatgcagtattaccagttacaaaacatccatgttgacatggatgatatatacattgtt
aatggtgttagtgagggaatctctatgtcaatgcaagctttgcttgataatgatgacgag
gttctagttccaatgccagattacccgttatggacagcttgtgttagccttgctggtgga
aatgctgtgcattatatttgtgatgaggaagctaattggtatcctgatattgatgatatc
aaatcaaaaatcacatccaaaacaaaagcaattgtcctcattaatccaaataatccaact
ggagcagtctatccgcgtgaaattctgcaagagattgtggatatcgctagacaaaatgac
ttgattattttttcagacgaggtttatgaccgtttagttatggatggaatggagcatatc
ccaattgcttctattgcagaggatatttttacagttactttatctggcttatctaaatca
catcgcatctgtggtttccgcgttggttggatggtattgtctggtccgcgacaacatgtt
aaaggttatattgaaggtttgaatatgttagctaacatgaggctgtgttcaaatgttctt
gctcaacaggttattcaaacatcgttaggcggacagcaatctattgatagtatgttgttg
ccaggaggtcgtatctacgagcaacgtaattatatccataaagcaattaatgaaatacct
ggtttatctgctgtaaaaccaaatgctggactgtatcttttccctaaaattgatacagat
atgtaccgtattgataatgatgaagagtttgtgcttaatttcttaaaacaagaaaaagta
ttactaacacacggtagaggatttaatatgaataccgctgaccattttagaattgtttac
ttaccacgtgttgatgaattgactgaactacaagaaaaaatggctcgctttttaagccga
tacaagcgctag

DBGET integrated database retrieval system