KEGG   Streptococcus agalactiae 09mas018883: BSA_18270Help
Entry
BSA_18270         CDS       T02703                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00260  Glycine, serine and threonine metabolism
sagm01100  Metabolic pathways
sagm01110  Biosynthesis of secondary metabolites
sagm01120  Microbial metabolism in diverse environments
sagm01130  Biosynthesis of antibiotics
sagm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSA_18270
Enzymes [BR:sagm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BSA_18270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCW38594
Position
complement(1787131..1788156)
Genome map
AA seq 341 aa AA seqDB search
MLHFENDYNKGAHPELLNALIETNDQGLSGYRTDSYCQQAADKIREVCSCPQAEVEFLVG
GTQTNQVVISSMLASYEGVIAAETGHVSSHEAGAIEFSGHKVLTLPSHNGKLLASEVATY
IETFYADGNYQHMVFPGMVYISHPTEYGTLYSKAELEELSKICKHYQIPLFIDGARLGYG
LAAKDTDVDFPTIAALSDVFYIGGTKMGALAGEAVVFTKKNRPKQFTTIVKQHGALLAKG
RLLGLAFDRFFTDDLYLKIGKHAIDLAEELKIILEEKGYSFYLKSPTNQQFIIVENTKLA
DLAKNVAYSFWEKYDDHHTVIRLATSWSTSREDVTALRNVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgattataataaaggagctcatccagagcttttgaatgccctt
attgaaactaatgatcaaggtctatcgggatataggacagatagttactgtcaacaagcg
gcagataaaattcgagaagtctgttcctgtccacaagctgaagttgagtttttagtgggt
ggtactcaaacaaatcaagtagttatcagtagtatgcttgcttcttatgaaggagttatt
gctgcagaaacaggtcatgtgagtagtcatgaagcaggagccatagaattttcaggtcat
aaggtattgactttaccttctcataatgggaaattactcgcaagcgaagttgcaacttat
attgagactttttatgctgatggtaattaccaacacatggtttttccaggaatggtttat
atatcacatccaacagaatatggaacactttatagtaaagcagaactagaagagttgtcg
aagatttgtaaacattatcaaatccccttatttattgacggtgctcgtctggggtatggt
ttggctgcgaaagatacagatgttgatttcccaacgattgcagccttatcagatgttttt
tatattggcggaactaaaatgggggctcttgctggggaagcagttgttttcacaaagaaa
aatcgtccaaaacagtttactacaattgtaaagcagcatggtgcgttattagccaaggga
agattgctgggacttgcttttgatcgtttctttacggatgacctttacttaaaaattgga
aagcatgcgatcgacttagcagaggaattaaaaatcattttagaagaaaaaggttactca
ttctatttaaaatcaccaactaatcaacaatttattattgtagaaaatacaaaactagca
gatttagcaaagaatgtagcttatagtttttgggaaaaatatgatgaccatcatactgta
atacgtctagcaactagttggtcaactagtcgcgaagatgtaactgctttaagaaatgtc
ttgtga

DBGET integrated database retrieval system