KEGG   Streptococcus agalactiae 09mas018883: BSA_20350Help
Entry
BSA_20350         CDS       T02703                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00561  Glycerolipid metabolism
sagm00640  Propanoate metabolism
sagm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSA_20350
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSA_20350
Enzymes [BR:sagm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BSA_20350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Herpes_UL73
Motif
Other DBs
NCBI-ProteinID: CCW38800
Position
1983904..1984989
Genome map
AA seq 361 aa AA seqDB search
MTTNVMANYSYGEDCFKEIPSVLATYRIQSIAFVGGKRALDSSEAEVRSILEEANIKVTG
SFVYGTDSTQSNIDKLVANPQVQAADAILGFGGGKALDTAKMVAKELGKNSFTIPTICSN
CSAGTAIAVVYNDDHSFLRYGYPESPLHIFINTRIIAQAPSKYFWAGIGDGISKAPEVER
ATLEAKTNKLPHTAVLGQAVALSSKEAFYQFGEQGLKDVEANLASRAVEEIALDILISTG
YASNLVNQPDFYYNSCHAHAFYYGTTAIQRQGEFLHGVVVAFGVLVLHAYFNELEELEKV
ARFNKSLGLPTTLADVSLSEKDIPKIVEIAMTTNEYKNTPFDPKMFAQAILAADAFGQTL
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaatgtaatggcaaattatagctacggagaagattgcttcaaagaaattcct
agcgttttggcaacttaccgtattcaaagcattgctttcgtcggtggcaaacgtgcccta
gacagctcagaagccgaggttcgctctattttagaggaagcaaatattaaagtcacagga
agctttgtctatggaacggattcaacacaatctaacattgacaagttagtagccaaccca
caagttcaagctgctgatgctatcttaggttttggcggtggaaaagctttagacacagct
aaaatggtagcaaaagagttaggtaaaaatagctttactatcccaactatttgttctaat
tgctccgcaggtactgccattgcagttgtatataatgatgaccattctttcttaagatac
ggctatcccgagtctccacttcatatttttatcaatacacggatcattgcacaggcacca
agcaaatatttttgggctggtattggggacggtatttcaaaagcccctgaagtagaacgt
gctaccttagaggctaagaccaataaactaccacatactgcagtgttaggacaagcagtc
gctctgtcttcaaaggaagctttttatcaatttggtgaacaaggtctaaaagacgttgaa
gctaatttagcttcgcgtgcagttgaagaaattgcgcttgatatcttaatctcaactggc
tatgcttctaatttagttaatcaacctgatttctactacaattcttgtcacgcgcatgca
ttttactatggtacaaccgctattcaaagacaaggtgaattcttacatggcgttgtagtt
gcgtttggtgtgttagttttacatgcttatttcaacgaactagaagaacttgaaaaagta
gctcgttttaataagtcactaggtttgccaacaactctagctgacgtctctttatcagaa
aaagatattccaaaaattgttgaaattgcaatgactactaatgaatacaaaaatacccct
ttcgatcccaaaatgtttgctcaagctattttagcagcagacgctttcggacagacacta
gcctaa

DBGET integrated database retrieval system