KEGG   Streptococcus agalactiae 09mas018883: BSA_2290Help
Entry
BSA_2290          CDS       T02703                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00430  Taurine and hypotaurine metabolism
sagm00620  Pyruvate metabolism
sagm00640  Propanoate metabolism
sagm00680  Methane metabolism
sagm01100  Metabolic pathways
sagm01120  Microbial metabolism in diverse environments
sagm01200  Carbon metabolism
Module
sagm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sagm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSA_2290
   00640 Propanoate metabolism
    BSA_2290
  09102 Energy metabolism
   00680 Methane metabolism
    BSA_2290
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSA_2290
Enzymes [BR:sagm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BSA_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CCW37033
Position
191864..193057
Genome map
AA seq 397 aa AA seqDB search
MSKTIAINAGSSSLKWQLYEMPEEKVVAKGIIERIGLKDSISTVKFDDKKDEQILDIVDH
TQAVKILLEDLTKHGIIKDFNEITGVGHRVVAGGEYFKESALVDDKVVEQVEELSALAPL
HNPAAAAGIRAFREILPDITSVCVFDTAFHTTMQPHTYLYPIPQKYYTDYKVRKYGAHGT
SHQYVAQEAAKQLGRPLEELKLITAHVGNGVSITANYHGQSIDTSMGFTPLAGPMMGTRS
GDIDPAIIPYLVANDPELEDAAAVVNMLNKQSGLLGVSGTSSDMRDIEAGLQSKDPNAVL
AYNVFIDRIKKFIGQYLAVLNGADAIIFTAGMGENAPLMRQDVIAGLSWFGIELDPEKNV
FGYFGDITKPDSKVKVLVIPTDEELMIARDVERLKAK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacaatagcaattaatgctggaagttcaagtttgaaatggcaattatatgaa
atgccagaggagaaagtagttgccaaagggattatcgaacgtattggtttgaaagattct
atttcgactgtaaaatttgacgataaaaaagatgaacaaattttagatatcgtagatcat
acccaagctgttaaaattcttttagaagatctaacaaaacatggtattatcaaagacttt
aatgaaattacaggtgttggtcatcgtgtcgttgctggtggtgaatattttaaagagtct
gctttagtagatgataaagttgtagaacaggttgaagaattatcagctttagctccactc
cacaacccagcagctgcagcagggattcgtgcgtttagagaaatcttaccagatatcacg
agtgtatgtgtatttgatacagccttccatacaacaatgcaacctcatacctacttatat
ccaatcccacaaaagtactatactgattataaagtacgtaaatacggtgcacacgggaca
agccaccaatacgttgcacaagaagcagctaagcaattaggacgtcctttagaagaatta
aaattaatcacagcacatgtgggtaatggtgtttctattacagcaaattatcatggacag
tctattgatacatcaatgggattcacaccacttgcaggaccaatgatgggaacacgttca
ggagacattgatcctgcgattatcccttatcttgtagctaatgatccagaattggaagat
gcagcagctgttgttaatatgcttaacaaacaatcaggattgcttggagtatcaggaact
tcaagtgatatgcgagatattgaagcaggtcttcaaagtaaagatccaaatgcagtgtta
gcctataatgtctttattgaccgtattaagaaatttattggacaatacttggcagtatta
aatggcgcggatgctattatttttactgcaggtatgggagaaaatgcgccattaatgcgt
caagatgttatcgcaggattatcatggtttggcattgaacttgatccagaaaaaaatgtt
tttggttattttggagatatcacaaaaccagattcaaaagtgaaggttttagttattcct
actgatgaagaattaatgattgcgcgtgacgttgagcgccttaaagctaaataa

DBGET integrated database retrieval system