KEGG   Streptococcus agalactiae 09mas018883: BSA_5560Help
Entry
BSA_5560          CDS       T02703                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00071  Fatty acid degradation
sagm00072  Synthesis and degradation of ketone bodies
sagm00280  Valine, leucine and isoleucine degradation
sagm00310  Lysine degradation
sagm00362  Benzoate degradation
sagm00380  Tryptophan metabolism
sagm00620  Pyruvate metabolism
sagm00630  Glyoxylate and dicarboxylate metabolism
sagm00640  Propanoate metabolism
sagm00650  Butanoate metabolism
sagm00900  Terpenoid backbone biosynthesis
sagm01100  Metabolic pathways
sagm01110  Biosynthesis of secondary metabolites
sagm01120  Microbial metabolism in diverse environments
sagm01130  Biosynthesis of antibiotics
sagm01200  Carbon metabolism
sagm01212  Fatty acid metabolism
sagm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSA_5560
   00630 Glyoxylate and dicarboxylate metabolism
    BSA_5560
   00640 Propanoate metabolism
    BSA_5560
   00650 Butanoate metabolism
    BSA_5560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSA_5560
   00072 Synthesis and degradation of ketone bodies
    BSA_5560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSA_5560
   00310 Lysine degradation
    BSA_5560
   00380 Tryptophan metabolism
    BSA_5560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSA_5560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSA_5560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSA_5560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagm04147]
    BSA_5560
Enzymes [BR:sagm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSA_5560
Exosome [BR:sagm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSA_5560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CCW37329
Position
487415..488530
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttatgctaaagaagataatcgtaacggagaatatacagttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctctattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system