KEGG   Streptococcus agalactiae CNCTC 10/84: W903_0589Help
Entry
W903_0589         CDS       T03518                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Pathway
sagn00071  Fatty acid degradation
sagn00072  Synthesis and degradation of ketone bodies
sagn00280  Valine, leucine and isoleucine degradation
sagn00310  Lysine degradation
sagn00362  Benzoate degradation
sagn00380  Tryptophan metabolism
sagn00620  Pyruvate metabolism
sagn00630  Glyoxylate and dicarboxylate metabolism
sagn00640  Propanoate metabolism
sagn00650  Butanoate metabolism
sagn00900  Terpenoid backbone biosynthesis
sagn01100  Metabolic pathways
sagn01110  Biosynthesis of secondary metabolites
sagn01120  Microbial metabolism in diverse environments
sagn01130  Biosynthesis of antibiotics
sagn01200  Carbon metabolism
sagn01212  Fatty acid metabolism
sagn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    W903_0589
   00630 Glyoxylate and dicarboxylate metabolism
    W903_0589
   00640 Propanoate metabolism
    W903_0589
   00650 Butanoate metabolism
    W903_0589
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W903_0589
   00072 Synthesis and degradation of ketone bodies
    W903_0589
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W903_0589
   00310 Lysine degradation
    W903_0589
   00380 Tryptophan metabolism
    W903_0589
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W903_0589
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W903_0589
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    W903_0589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagn04147]
    W903_0589
Enzymes [BR:sagn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     W903_0589
Exosome [BR:sagn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W903_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AIX04287
Position
512784..513899
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAYLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKEAFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcatacctcttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaagcattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system