KEGG   Streptococcus agalactiae CNCTC 10/84: W903_0590Help
Entry
W903_0590         CDS       T03518                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Pathway
sagn00061  Fatty acid biosynthesis
sagn00071  Fatty acid degradation
sagn01100  Metabolic pathways
sagn01212  Fatty acid metabolism
sagn02024  Quorum sensing
Module
sagn_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sagn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    W903_0590
   00071 Fatty acid degradation
    W903_0590
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    W903_0590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sagn01004]
    W903_0590
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagn04147]
    W903_0590
Enzymes [BR:sagn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     W903_0590
Lipid biosynthesis proteins [BR:sagn01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   W903_0590
Exosome [BR:sagn04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   W903_0590
  Exosomal proteins of breast cancer cells
   W903_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C PARP_reg
Motif
Other DBs
NCBI-ProteinID: AIX04288
Position
513892..515121
Genome map
AA seq 409 aa AA seqDB search
MLESLKTIVKTNSDKKLFDGDLQVSYGEFYNLVRQDMASQDNRKHVISTHSLLNQLVRFV
SKLCQKALPIICKPNLTHNEISRLEKEVQYAPQLADFGVLSSGTTADAKLLWRSFASWSD
FFSIQNAYFSVTSNSRLFIQGDFSFTGNLNLALSLLLLGGTLVVTQKNSVKYWQTLWEKT
GVTHLYLLPSYLKLVEQYSKETALDNKTIITSSQYVSDSLLEGLYIKHPKVSVKIFYGAS
ELNYVSWYDGRDIRDKPQYVGEIVPNVAVRIKEGRIFVKTPYSICGLSSEYCAGDYGELI
DGKLYLFGRGGDWCNQSGIKLYLPRLIEKIKTCPYIKDAVAFTKESQSHGQESHCCIVLI
ENQMQQECLKWLSEHFEKKYGFKHYHIVSKIPLMPSGKIDYQQLKRQLT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatcattgaaaacaatagttaaaaccaatagcgataaaaagttatttgatggt
gatttacaggtcagttatggagaattttataacttagtcagacaagatatggcgtcacaa
gacaataggaaacatgtgattagcacacactctctgcttaaccaattagtaagatttgtt
tcaaagttatgtcaaaaagctcttcctattatttgtaaacctaaccttactcataatgaa
ataagtcgattagaaaaagaagtgcagtatgctcctcaactagctgattttggtgttctt
tcttctgggactacagctgatgctaaactattgtggaggagcttcgcttcgtggtctgat
ttttttagcattcagaatgcttatttttcggtcacttccaatagcagactgtttattcaa
ggtgatttttcatttactggtaacttaaatttagcgctatcccttttattactgggggga
acgcttgttgtcacacagaaaaattctgtaaaatactggcagactttatgggaaaaaact
ggtgtaacgcatctatatctgctccctagttatctcaagttagtggaacaatatagcaag
gagactgcgttagacaataaaactattattacctcttcgcaatatgtctctgactcatta
ctggaaggtttatatataaagcatcctaaagtgtcagtgaaaatcttctatggtgctagt
gaactcaattatgtgtcatggtacgatggtcgtgatatccgagataagccacagtatgtt
ggagaaatcgttccaaatgtagctgttaggattaaagagggaagaatttttgtaaaaaca
ccgtatagtatctgtggcctttcaagtgaatattgtgctggtgattatggtgaactgata
gatggcaaattatatctatttggtcgtggtggtgattggtgcaatcaatcgggcattaag
ctctatttacctagattaatcgaaaaaataaaaacatgcccttatatcaaggatgcagta
gcatttacaaaagagagtcaaagtcatggacaagagtcacattgctgtattgttttaatt
gaaaatcagatgcaacaagagtgtttgaagtggttatcggaacattttgaaaagaagtat
gggtttaagcattatcatattgtatctaaaattcctttgatgccatctggaaaaattgat
tatcaacaactcaaaagacaattaacatga

DBGET integrated database retrieval system