KEGG   Streptococcus agalactiae 138P: V193_02870Help
Entry
V193_02870        CDS       T03183                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sagp  Streptococcus agalactiae 138P
Pathway
sagp00010  Glycolysis / Gluconeogenesis
sagp00030  Pentose phosphate pathway
sagp00051  Fructose and mannose metabolism
sagp00680  Methane metabolism
sagp01100  Metabolic pathways
sagp01110  Biosynthesis of secondary metabolites
sagp01120  Microbial metabolism in diverse environments
sagp01130  Biosynthesis of antibiotics
sagp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    V193_02870
   00030 Pentose phosphate pathway
    V193_02870
   00051 Fructose and mannose metabolism
    V193_02870
  09102 Energy metabolism
   00680 Methane metabolism
    V193_02870
Enzymes [BR:sagp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     V193_02870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AHN30128
Position
517537..519468
Genome map
AA seq 643 aa AA seqDB search
MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEYDAVDYLLRTGAGSI
RAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLSASAYKTKLWEMIPLQIQVLK
YFSSKYTKSKVRKQLPGKFAYIIEELLAEIDRNPEKESYFDTIIEKLFELDQVEDLIIVL
SQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFPNLDIQWGNHDVTWMGAASGSYLCM
VNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYEPLPSFAPILDGEEMTHPDELDLLN
MIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKDLSISIKEVVHQLKDFNSRCID
SKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEKGSMYLTYNDNLLFHGCIPMHSN
GDFKSFKIAGKTYGGRDLLDLFESQIRLAYARPEKHDDLATDIIWYLWCGENSSLFGKNA
MTTFERYYVSDKVTHQERKNPYFKLRDKDDICTALLQEFDLPKFGHIVNGHTPVKEKNGE
QPIKANGKMLVIDGGFAKGYQKNTGLAGYTLIYNSYGIQLISHLPFTSIEEVLSGTNYII
DTKRLVEEAKDRILVKDTTIGQKLTKEIKDLDHLYHHFQEYDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttttataagctcttgaaagaaaaatttcctcgaaaagaagatatcgtaaca
gaaatgatcaatttagaagctatttgtcaattacccaaagggacggaatattttattagt
gatttacacggggaatatgatgctgttgattatctcttacggacaggtgcagggtctatt
agagctaaattattagactgctttgattggcagaaaatagttgctgttgatttagatgat
ttttgtatactgctttattacccaaaggaaaaattagccttcgataaaatgaacttgtca
gcaagtgcttataaaacgaagttatgggaaatgattccgttacaaatacaagttttaaaa
tatttttctagtaaatatacaaaatctaaagtgcgtaagcaattgccaggtaagtttgct
tacattatcgaagaacttttagctgagattgaccgtaacccagagaaggaaagctatttt
gatactattattgaaaaattatttgaattagaccaagtagaagatttaattatagtattg
tcccaaacaattcaagttttaatcattgaccatttacatgttgtaggggatatttacgat
cgtggtaggtatcctgatcgtattttgaataggttaatggctttcccaaatttggatatc
caatgggggaaccatgatgtcacttggatgggagcagcatctggttcctacctttgtatg
gtaaatgttatccgtattgctgcacgttataataatattactttaattgaagaccgatat
ggtattaatttgcgtcgcttggttgattactcacgccgttactatgaacctctaccttct
ttcgcacctatattagatggagaggaaatgactcatccagatgaattagacttgttaaat
atgatacaacaagcaacagcaattttacagtttaaattggaagcccaattgattgacagg
cgtccagaatttcaaatgcataatcggcaacttattaaccaggtaaattataaagattta
agtatatctattaaggaagttgtgcatcaacttaaagattttaatagtagatgcattgat
tcgaaaaatcccagtcgattaacaagtgaggaagaagagcttttacaacaattgatgata
gccttccagacttctgaaagtttaaagaaacatattgatttcttatttgagaaaggaagt
atgtatttaacctataatgataatcttttattccatggttgcataccaatgcatagtaat
ggtgattttaaaagctttaaaattgcaggaaaaacttatggtggtagggatttactggat
ttatttgaaagtcaaatacgtctagcatatgctagaccagagaaacatgatgatttggcg
acagatatcatttggtatctttggtgtggtgaaaattcttctctttttggtaagaatgcc
atgactacttttgagcgctattatgtttccgacaaagtaactcatcaagaaagaaaaaat
ccctactttaaactgagagataaagatgatatttgcactgctcttttacaagagtttgat
ttgcctaagtttgggcatattgtcaatggtcatacgccagtcaaagaaaaaaatggtgag
caaccgataaaagcaaatggtaagatgttagtaattgatggtggctttgccaaaggttat
cagaaaaatacaggtttagctggctacactttgatttataatagctatgggatacaatta
atttcacaccttccttttacatccattgaggaagttttaagtggaaccaactatatcatt
gatacgaagcgattagtagaagaagccaaggataggattcttgtaaaagatacaactatt
ggacaaaagttaaccaaagagattaaagacttagatcacctttatcatcattttcaggaa
tatgatgactag

DBGET integrated database retrieval system