KEGG   Streptococcus agalactiae 138P: V193_07870Help
Entry
V193_07870        CDS       T03183                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sagp  Streptococcus agalactiae 138P
Pathway
sagp00260  Glycine, serine and threonine metabolism
sagp01100  Metabolic pathways
sagp01110  Biosynthesis of secondary metabolites
sagp01120  Microbial metabolism in diverse environments
sagp01130  Biosynthesis of antibiotics
sagp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    V193_07870
Enzymes [BR:sagp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     V193_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHN31010
Position
complement(1530344..1531369)
Genome map
AA seq 341 aa AA seqDB search
MLHFENDYNKGAHPELLNALIETNDQGLSGYGTDSYCQQAADKIREVCSCPQAEVEFLVG
GTQTNQVVISSMLASYEGVIAAETGHVSSHEAGAIEFSGHKVLTLPSHNGKLLASEVATY
IETFYADGNYQHMVFPGMVYISHPTEYGTLYSKAELEELSKICKHYQIPLFIDGARLGYG
LAAKDTDVDFPTIAALSDVFYIGGTKMGALAGEAVVFTKKNRPKQFTTIVKQHGALLAKG
RLLGLAFDRFFTDDLYLKIGKHAIDLAEELKIILEEKGYSFYLKSPTNQQFIIVENTKLA
DLAKNVAYSFWEKYDDHHTVIRLATSWSTSREDITALRNVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgattataataaaggagctcatccagagcttttgaatgccctt
attgaaactaatgatcaaggtctatcgggatatgggacagatagttactgtcaacaagcg
gcagataaaattcgagaagtctgttcctgtccacaagctgaagttgagtttttagtgggt
ggtactcaaacaaatcaagtagttatcagtagtatgcttgcttcttatgaaggagttatt
gctgcagaaacaggtcatgtgagtagtcatgaagcaggagccatagaattttcaggtcat
aaggtattgactttaccttctcataatgggaaattactcgcaagcgaagttgcaacttat
attgagactttttatgctgatggtaattaccaacacatggtttttccaggaatggtttat
atatcacatccaacagaatatggaacactttatagtaaagcagaactagaagagttatcg
aagatttgtaaacattatcaaatccccttatttattgacggtgctcgtctggggtatggt
ttggctgcgaaagatacagatgttgatttcccaacgattgcagccttatcagatgttttt
tatattggtggaaccaaaatgggggctcttgctggggaagcagttgttttcacaaagaaa
aatcgtccaaaacagtttactacaattgtaaagcagcatggtgcgttattagccaaggga
agattgctggggcttgcttttgatcgtttctttacggatgacctttacttaaagattgga
aagcatgcgattgacttagcagaggaattaaaaatcattttagaagaaaaaggttactcg
ttctatttaaaatcaccaactaatcaacaatttattattgtagaaaatacaaaactagca
gatttagcaaagaatgtagcttatagtttttgggaaaaatatgatgaccatcatactgta
atacgtctagcaactagttggtcaactagtcgcgaagatataactgctttaagaaatgtc
ttgtga

DBGET integrated database retrieval system