KEGG   Staphylococcus agnetis: EP23_11380Help
Entry
EP23_11380        CDS       T04155                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagq  Staphylococcus agnetis
Pathway
sagq00071  Fatty acid degradation
sagq00280  Valine, leucine and isoleucine degradation
sagq00310  Lysine degradation
sagq00362  Benzoate degradation
sagq00380  Tryptophan metabolism
sagq00620  Pyruvate metabolism
sagq00630  Glyoxylate and dicarboxylate metabolism
sagq00640  Propanoate metabolism
sagq00650  Butanoate metabolism
sagq00900  Terpenoid backbone biosynthesis
sagq01100  Metabolic pathways
sagq01110  Biosynthesis of secondary metabolites
sagq01120  Microbial metabolism in diverse environments
sagq01130  Biosynthesis of antibiotics
sagq01200  Carbon metabolism
sagq01212  Fatty acid metabolism
sagq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP23_11380
   00630 Glyoxylate and dicarboxylate metabolism
    EP23_11380
   00640 Propanoate metabolism
    EP23_11380
   00650 Butanoate metabolism
    EP23_11380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP23_11380
   00072 Synthesis and degradation of ketone bodies
    EP23_11380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP23_11380
   00310 Lysine degradation
    EP23_11380
   00380 Tryptophan metabolism
    EP23_11380
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EP23_11380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EP23_11380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EP23_11380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagq04147]
    EP23_11380
Enzymes [BR:sagq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EP23_11380
Exosome [BR:sagq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EP23_11380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALN77890
Position
2318609..2319748
Genome map
AA seq 379 aa AA seqDB search
MNKAVIVAAKRTPIGVYGGKLNKWEPEDLLKPLLQHFQKMLPCDLNTLDDVILGNVVGNG
GNIARKSLLEAGIDVRVPGLTIDRQCGSGLEAIQLACRLVESGAGDFYIAGGVESTSRAP
WKMKRPTSLYPSEPPQFFERASFAPSDQDPSMIEAAENVAHTFQITREDQDRFAYTSHIK
TAKASENHQLDDEIVPLKVQGSWMTHDESVRPDIKLSRLKRLKPLLPNGTVTVGNCCLKH
DGAALVVVMSQEKARTLGLTKGLYFKGYAIEGVAPTLLGSGPIPAVKELLEKHHLTITDI
DAVELNEAFSAQVLACQRELNISDAQLNRYGGAIAMGHPYSASGAILVTRLLYMTDAMRT
IATMGIGGGMGNAALFERW
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcagtaatagtggcggcaaaacgaacgccgataggggtatatggtggtaag
ttaaataaatgggaaccagaagatttactgaaaccattactgcaacattttcagaagatg
ctcccatgcgatttgaatacattagatgatgtcattttaggtaatgtggttggaaatggt
ggaaatattgcacgcaaaagtctgttagaagcaggcattgatgtacgtgtgcctggttta
acaattgatcgtcaatgtgggtcgggtttagaggcgatccaattagcgtgtcgtcttgta
gaaagtggtgcaggtgacttttatattgcaggaggcgtagagagtacaagccgggcacct
tggaaaatgaagcgaccgacgtctctctatccttcagagcctccacaattttttgagcgt
gcctcattcgcaccaagcgatcaagatccgtccatgattgaggcagctgaaaatgtagcc
catacctttcaaataacgcgagaggatcaggacagatttgcatataccagtcacattaaa
actgctaaagcttctgaaaatcatcaacttgacgatgaaatcgtacctttaaaagttcaa
ggatcatggatgacgcatgatgaaagtgtacgtcctgatattaaattatcgcgcttaaaa
cgtttaaagccgttacttccaaatggcactgtaacagtagggaattgctgtttaaagcat
gacggggcagcgcttgtagttgtaatgtcacaagaaaaagcacgtacgcttggtctaact
aaagggttatattttaaaggctacgcgattgaaggggttgcgcctacgcttttaggaagt
gggcccattccagcggtaaaagaacttttagaaaagcatcatctgactataacagatatt
gacgcggtagagttgaatgaagcttttagcgcacaagtacttgcatgccaacgagagctt
aatatttctgacgcacaactcaaccgatacggtggcgctattgcgatgggacatccctac
agtgcaagtggggctattttagtgacgcgcttgttgtacatgacagatgcaatgcggacg
atagcgacgatgggtattggaggaggcatgggtaatgcagcactgttcgaacgttggtga

DBGET integrated database retrieval system