KEGG   Staphylococcus agnetis: EP23_11755Help
Entry
EP23_11755        CDS       T04155                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sagq  Staphylococcus agnetis
Brite
KEGG Orthology (KO) [BR:sagq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EP23_11755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALN77958
UniProt: A0A242VER5
Position
2389536..2390537
Genome map
AA seq 333 aa AA seqDB search
MELLVLITVAIVIFSLVFDFINGFHDTANAVATAVSTRALTPRHAILLAAIMNFIGALTF
TGVATTITKDIVDPFTIHNGLVVVLAAILAAIVWNLVTWYFGIPSSSSHALIGAIAGSAV
ASAGSFSILHFQGFTKIVLVLLLSPVIAFIVGFTIYSIVKKVFKNANLARTNQNFRFFQI
FTAALQSFSHGTNDAQKSMGIITMALIVANLQSDVEPALWVKISCAAAMGLGTAVGGWRI
IKTVGGNIMKIRPANGAAADLSSALTIFTASYLHFPLSTTHVVSSSILGVGSANRIKGVH
WNTAKRMIVTWVITLPITAIIAAIFYFILNLFI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaattattagtgctgataacggtggctattgttatattttcattagtgtttgatttt
attaacgggtttcatgacacagccaatgctgtagccactgctgtttctacgcgtgcatta
acacctagacatgcgattttattagcggccattatgaattttattggtgccttaactttt
acaggtgtagcaacaacaataacaaaagacattgttgatccatttacgattcacaatggt
ttggttgttgtgttagcagcgattttagcagccattgtatggaacttggtgacatggtat
tttggaattcctagttcatcatcacacgcgctgattggggcgattgctggatcagcggtt
gcttcagcaggttcatttagtattttacactttcaagggtttacgaaaatcgttttagta
ttattactttcaccagtcatcgcttttatcgtcgggtttacgatttattcaattgtaaaa
aaagtatttaaaaatgcgaatcttgcacgaacgaatcaaaacttccgatttttccaaatt
tttacagcagcgttgcaatctttttctcacggtacaaatgatgctcaaaagtcaatgggg
attattacgatggcattgatcgtagccaatcttcaatcagacgtagagcctgcattatgg
gttaaaatttcatgtgctgcagcaatggggctcggaaccgcagttggtggttggcgtatt
attaaaacagtcggtggaaacattatgaaaattcgtcctgccaatggcgcagctgcagac
ctttcttctgcattgacaattttcacagcgtcttatcttcactttccactctcaacgaca
cacgttgtatcctcatctattttaggtgtaggctcagctaatagaattaaaggtgttcat
tggaatacagcaaaacgtatgattgtgacatgggtaattacattaccaatcactgcaatc
attgcagctattttctatttcattttgaacctctttatataa

DBGET integrated database retrieval system