KEGG   Streptococcus agalactiae ILRI112: SAIL_10360Help
Entry
SAIL_10360        CDS       T02705                                 

Definition
(GenBank) Hypothetical NagD-like phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00627  Aminobenzoate degradation
sagr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sagr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAIL_10360
Enzymes [BR:sagr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SAIL_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3 PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: CCW42053
Structure
PDB: 

Position
953339..954109
Genome map
AA seq 256 aa AA seqDB search
MAYKGYLIDLDGTIYKGKSRIPAGERFIERLQEKGIPYMLVTNNTTRTPESVQEMLRGFN
VETPLETIYTATMATVDYMNDMNRGKTAYVIGEEGLKKAIADAGYVEDTKNPAYVVVGLD
WNVTYDKLATATLAIQNGALFIGTNPDLNIPTERGLLPGAGSLNALLEAATRIKPVFIGK
PNAIIMNKALEILNIPRNQAVMVGDNYLTDIMAGINNDIDTLLVTTGFTTVEEVPDLPIQ
PSYVLASLDEWTFNEG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaaggatatcttattgatttagatggtactatttacaaagggaaaagtcgt
atcccagcaggagagcgttttatcgaacgcttgcaagaaaaaggcattccttatatgtta
gtaactaataatacgactcgtacaccagaaagcgttcaggaaatgcttcgaggcttcaat
gttgaaacaccacttgaaacaatctataccgcaactatggctacggttgactatatgaat
gatatgaaccgtggaaaaacagcttacgttattggtgaagaagggcttaaaaaagctatt
gcagatgcaggttatgtggaggatacaaaaaatccagcctatgtggttgttggtttagat
tggaatgttacttatgataaattggcaactgctacgttagcaattcaaaatggtgcttta
tttattggaaccaatccagatctgaatattcctactgagcgtggtttattacccggtgct
ggctccttaaatgctttattagaagccgcaacgcgtataaaaccagtctttattggaaag
ccaaatgccatcattatgaataaggcacttgaaattttaaatattcctaggaatcaagca
gtcatggtcggtgataattatttgacagatatcatggctggtattaataatgatattgat
actttgttagtaacaacgggttttacaacagttgaagaagtaccagatttaccaattcaa
ccaagttatgttttagcaagtttagatgaatggacatttaatgaaggataa

DBGET integrated database retrieval system