KEGG   Streptococcus agalactiae ILRI112: SAIL_17020Help
Entry
SAIL_17020        CDS       T02705                                 

Definition
(GenBank) Phosphoenolpyruvate-dihydroxyacetone phosphotransferase, ADP-binding subunit DhaL
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00561  Glycerolipid metabolism
sagr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAIL_17020
Enzymes [BR:sagr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     SAIL_17020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2 RFC1 DUF1160
Motif
Other DBs
NCBI-ProteinID: CCW42714
Position
1593828..1594406
Genome map
AA seq 192 aa AA seqDB search
MEVKTAIEWMHTFNQKIQSNKDYLSELDTPIGDGDHGGNMARGMTAVIENLDNNEFSSAA
DVFKTVSMQLLSKVGGASGPLYGSAFMGITKAEQSESTISEALGAGLEMIQKRGKAELNE
KTMVDVWHGVIEAIEKNELTEDRIDSLVDATKGMKATKGRASYVGERSVGHIDPGSFSSG
LLFKALLEVGGV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaactgcaatagaatggatgcacacttttaaccaaaaaattcaatccaac
aaggactatttatccgaactagatactccaataggtgatggcgaccatggtggcaatatg
gcgcgtggtatgactgctgttattgaaaaccttgataacaatgaatttagtagtgctgcc
gatgttttcaaaaccgtatccatgcaacttttaagcaaagtaggtggagcatctggacca
ctctatggttctgcatttatgggaattacaaaagctgaacagagtgaaagtaccatttca
gaggcacttggcgcaggacttgaaatgattcaaaaacgtggtaaagctgaacttaatgaa
aaaacaatggttgatgtttggcacggtgttattgaagcgattgaaaaaaatgaattgact
gaagaccgtatcgattccttagtagatgctacaaaagggatgaaagcaacaaaaggacgc
gcttcttatgttggagaacgctcagtaggacacattgatccaggatcattttcttcagga
ttattatttaaagcattactagaagttggaggtgtctaa

DBGET integrated database retrieval system